Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1012
Gene name	Cadherin 13
Gene symbol	CDH13
Synonyms (NCBI Gene)	CDHHP105
Chromosome	16
Chromosome location	16q23.3
Summary	This gene encodes a member of the cadherin superfamily. The encoded protein is localized to the surface of the cell membrane and is anchored by a GPI moiety, rather than by a transmembrane domain. The protein lacks the cytoplasmic domain characteristic of

Show/Hide all (75)

miRTarBase ID	miRNA	Experiments	Reference
MIRT021007	hsa-miR-155-5p	Proteomics	18668040
MIRT024070	hsa-miR-1-3p	Proteomics	18668040
MIRT053689	hsa-miR-181a-5p	Microarray	22942087
MIRT617196	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT617195	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT617194	hsa-miR-31-3p	HITS-CLIP	23824327
MIRT617193	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT617192	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT617191	hsa-miR-4307	HITS-CLIP	23824327
MIRT617190	hsa-miR-4464	HITS-CLIP	23824327
MIRT617196	hsa-miR-1266-3p	HITS-CLIP	23824327
MIRT617195	hsa-miR-367-5p	HITS-CLIP	23824327
MIRT617194	hsa-miR-31-3p	HITS-CLIP	23824327
MIRT617193	hsa-miR-3074-5p	HITS-CLIP	23824327
MIRT617192	hsa-miR-7152-5p	HITS-CLIP	23824327
MIRT617191	hsa-miR-4307	HITS-CLIP	23824327
MIRT617190	hsa-miR-4464	HITS-CLIP	23824327
MIRT879678	hsa-miR-147b	CLIP-seq
MIRT879679	hsa-miR-1254	CLIP-seq
MIRT879678	hsa-miR-147b	CLIP-seq
MIRT879680	hsa-miR-3064-5p	CLIP-seq
MIRT879681	hsa-miR-3116	CLIP-seq
MIRT879682	hsa-miR-323b-5p	CLIP-seq
MIRT879683	hsa-miR-329	CLIP-seq
MIRT879684	hsa-miR-362-3p	CLIP-seq
MIRT879685	hsa-miR-3652	CLIP-seq
MIRT879686	hsa-miR-3688-5p	CLIP-seq
MIRT879687	hsa-miR-4289	CLIP-seq
MIRT879688	hsa-miR-4430	CLIP-seq
MIRT879689	hsa-miR-4474-3p	CLIP-seq
MIRT879690	hsa-miR-4505	CLIP-seq
MIRT879691	hsa-miR-4535	CLIP-seq
MIRT879692	hsa-miR-4800-5p	CLIP-seq
MIRT879693	hsa-miR-492	CLIP-seq
MIRT879694	hsa-miR-548n	CLIP-seq
MIRT879695	hsa-miR-616	CLIP-seq
MIRT879696	hsa-miR-661	CLIP-seq
MIRT2500604	hsa-miR-130a	CLIP-seq
MIRT2500605	hsa-miR-130b	CLIP-seq
MIRT879678	hsa-miR-147b	CLIP-seq
MIRT2500606	hsa-miR-153	CLIP-seq
MIRT2500607	hsa-miR-185	CLIP-seq
MIRT2500608	hsa-miR-19a	CLIP-seq
MIRT2500609	hsa-miR-19b	CLIP-seq
MIRT2500610	hsa-miR-301a	CLIP-seq
MIRT2500611	hsa-miR-301b	CLIP-seq
MIRT2500612	hsa-miR-3150b-3p	CLIP-seq
MIRT2500613	hsa-miR-3613-5p	CLIP-seq
MIRT2500614	hsa-miR-3650	CLIP-seq
MIRT2500615	hsa-miR-3666	CLIP-seq
MIRT2500616	hsa-miR-3682-3p	CLIP-seq
MIRT2500617	hsa-miR-376c	CLIP-seq
MIRT2500618	hsa-miR-4282	CLIP-seq
MIRT2500619	hsa-miR-4295	CLIP-seq
MIRT2500620	hsa-miR-4306	CLIP-seq
MIRT2500621	hsa-miR-4419a	CLIP-seq
MIRT2500622	hsa-miR-448	CLIP-seq
MIRT2500623	hsa-miR-4510	CLIP-seq
MIRT2500624	hsa-miR-454	CLIP-seq
MIRT2500625	hsa-miR-4644	CLIP-seq
MIRT2500626	hsa-miR-4689	CLIP-seq
MIRT2500627	hsa-miR-4699-3p	CLIP-seq
MIRT2500628	hsa-miR-4779	CLIP-seq
MIRT2500629	hsa-miR-4784	CLIP-seq
MIRT2500630	hsa-miR-519a	CLIP-seq
MIRT2500631	hsa-miR-519b-3p	CLIP-seq
MIRT2500632	hsa-miR-519c-3p	CLIP-seq
MIRT2500633	hsa-miR-552	CLIP-seq
MIRT2500634	hsa-miR-664	CLIP-seq
MIRT2500635	hsa-miR-668	CLIP-seq
MIRT2500636	hsa-miR-764	CLIP-seq
MIRT2500614	hsa-miR-3650	CLIP-seq
MIRT2500616	hsa-miR-3682-3p	CLIP-seq
MIRT2500618	hsa-miR-4282	CLIP-seq
MIRT2500635	hsa-miR-668	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
POU3F2	Unknown	23069940

Show/Hide all (64)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IBA
GO:0001938	Process	Positive regulation of endothelial cell proliferation	IMP	15364621
GO:0001954	Process	Positive regulation of cell-matrix adhesion	IMP	17573778
GO:0002040	Process	Sprouting angiogenesis	IDA	16873731
GO:0005509	Function	Calcium ion binding	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 32814053
GO:0005576	Component	Extracellular region	HDA	27068509
GO:0005615	Component	Extracellular space	IDA	16873731
GO:0005737	Component	Cytoplasm	IDA	10737605
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IDA	10737605
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005901	Component	Caveola	IDA	9650591
GO:0005912	Component	Adherens junction	IBA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007043	Process	Cell-cell junction assembly	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IDA	10601632
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0007162	Process	Negative regulation of cell adhesion	IDA	14729458
GO:0007266	Process	Rho protein signal transduction	IMP	15703273
GO:0008013	Function	Beta-catenin binding	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IDA	10737605
GO:0009897	Component	External side of plasma membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IDA	10601632
GO:0016342	Component	Catenin complex	IBA
GO:0016477	Process	Cell migration	IBA
GO:0016601	Process	Rac protein signal transduction	IMP	15703273
GO:0030032	Process	Lamellipodium assembly	IDA	15703273
GO:0030100	Process	Regulation of endocytosis	IMP	17573778
GO:0030169	Function	Low-density lipoprotein particle binding	IDA	16013438
GO:0030335	Process	Positive regulation of cell migration	IDA	14729458
GO:0031012	Component	Extracellular matrix	HDA	27559042
GO:0034332	Process	Adherens junction organization	IBA
GO:0042058	Process	Regulation of epidermal growth factor receptor signaling pathway	IMP	17573778
GO:0042802	Function	Identical protein binding	IEA
GO:0043005	Component	Neuron projection	IDA	10737605
GO:0043542	Process	Endothelial cell migration	IDA	14729458
GO:0043616	Process	Keratinocyte proliferation	IDA	15816843
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IBA
GO:0045202	Component	Synapse	IEA
GO:0045296	Function	Cadherin binding	IBA
GO:0045296	Function	Cadherin binding	IDA	10601632
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	16099944
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0048661	Process	Positive regulation of smooth muscle cell proliferation	IMP	15364621
GO:0050850	Process	Positive regulation of calcium-mediated signaling	IDA	16013438
GO:0050927	Process	Positive regulation of positive chemotaxis	IDA	16013438
GO:0051049	Process	Regulation of transport	IEA
GO:0051668	Process	Localization within membrane	IMP	17573778
GO:0055096	Process	Low-density lipoprotein particle mediated signaling	IDA	16013438
GO:0055100	Function	Adiponectin binding	IEA
GO:0055100	Function	Adiponectin binding	ISS
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0071466	Process	Cellular response to xenobiotic stimulus	IEA
GO:0071813	Function	Lipoprotein particle binding	IDA	11027617
GO:0097237	Process	Cellular response to toxic substance	IEA
GO:0098552	Component	Side of membrane	IEA
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098982	Component	GABA-ergic synapse	IEA

MIM	HGNC	e!Ensembl
601364	1753	ENSG00000140945

P55290

Protein name

Cadherin-13 (Heart cadherin) (H-cadherin) (P105) (Truncated cadherin) (T-cad) (T-cadherin)

Protein function

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. May act as a negative regu

PDB

2V37

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08758	Cadherin_pro	26 → 112	Cadherin prodomain like	Domain
PF00028	Cadherin	143 → 236	Cadherin domain	Domain
PF00028	Cadherin	250 → 354	Cadherin domain	Domain
PF00028	Cadherin	368 → 469	Cadherin domain	Domain
PF00028	Cadherin	483 → 576	Cadherin domain	Domain
PF00028	Cadherin	588 → 680	Cadherin domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in heart. In the CNS, expressed in cerebral cortex, medulla, hippocampus, amygdala, thalamus and substantia nigra. No expression detected in cerebellum or spinal cord. {ECO:0000269|PubMed:10737605, ECO:0000269|PubMed:8

Sequence

MQPRTPLVLCVLLSQVLLLTSAEDLDCTPGFQQKVFHINQPAEFIEDQSILNLTFSDCKG
NDKLRYEVSSPYFKVNSDGGLVALRNITAVGKTLFVHARTPHAEDMAELVIVGGKDIQGS
LQDIFKFARTSPVPRQKRSIVVSPILIPENQRQPFPRDVGKVVDSDRPERSKFRLTGKGV
DQEPKGIFRINENTGSVSVTRTLDREVIAVYQLFVETTDVNGKTLEGPVPLEVIVIDQND
NRPIFREGPYIGHVMEGSPTGTTVMRMTAFDADDPATDNALLRYNIRQQTPDKPSPNMFY
IDPEKGDIVTVVSPALLDRETLENPKYELIIEAQDMAGLDVGLTGTATATIMIDDKNDHS
PKFTKKEFQATVEEGAVGVIVNLTVEDKDDPTTGAWRAAYTIINGNPGQSFEIHTNPQTN
EGMLSVVKPLDYEISAFHTLLIKVENEDPLVPDVSYGPSSTATVHITVLDVNEGPVFYPD
PMMVTRQEDLSVGSVLLTVNATDPDSLQHQTIRYSVYKDPAGWLNINPINGTVDTTAVLD
RESPFVDNSVYTALFLAIDSGNPPATGTGTLLITLEDVNDNAPFIYPTVAEVCDDAKNLS
VVILGASDKDLHPNTDPFKFEIHKQAVPDKVWKISKINNTHALVSLLQNLNKANYNLPIM
VTDSGKPPMTNITDLRVQVCSCRNSKVDCNAAGALRFSLPSVLLLSLFSLACL

Sequence length

713

Interactions

View interactions

	Reactome
			Adherens junctions interactions

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
CDH13-related disorder	Uncertain significance; Likely benign; Benign	rs2507332983, rs199759196, rs748562344, rs537777339, rs779129520, rs151311546, rs777252024, rs201452763, rs189965190, rs541617175, rs377468582, rs757569853, rs150875489, rs192298176, rs200000145 View all (4 more)	RCV003406124 RCV003427847 RCV003904283 RCV003964520 RCV003916954 RCV003941785 RCV003961753 RCV003958905 RCV003944420 RCV003936785 RCV003944249 RCV003934661 RCV003944368 RCV003969207 RCV003960744 RCV003940546 RCV003910806 RCV003923086 RCV003978105
Cervical cancer	Uncertain significance	rs200608482	RCV005939108
Gastric cancer	Uncertain significance; Benign	rs200608482, rs117780495	RCV005939109 RCV005907644
Malignant tumor of esophagus	Benign	rs117780495	RCV005907643
Thymoma	Benign	rs17740895	RCV005915493
Thyroid cancer, nonmedullary, 1	Benign	rs117780495	RCV005907645
Uterine carcinosarcoma	Benign	rs17740895	RCV005915492

Show/Hide Text Mining Associations (117)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Adenocarcinoma	Associate	16598760, 17967182, 18729198, 25565774
Adenocarcinoma of Lung	Associate	17967182, 21731750, 27610375
Adenoma	Inhibit	14997203
Adenoma	Associate	17873891
Agnosia	Associate	25065733
Alcoholism	Associate	22064162
Alzheimer Disease	Associate	29771432, 35627222, 36553611
Apraxias	Associate	22738016
Arthritis Rheumatoid	Associate	20090771
Asthma	Associate	32186396
Astrocytoma	Associate	15367334
Atherosclerosis	Associate	25875811
Attention Deficit Disorder with Hyperactivity	Associate	20732627, 20963441, 21815997, 33972691, 34573337
Autistic Disorder	Associate	20963441, 22738016, 33972691, 34573337
Barrett Esophagus	Associate	18729198
Bipolar Disorder	Associate	24387768, 39999946
Blast Crisis	Associate	33557955
Brain Neoplasms	Associate	24968695
Breast Neoplasms	Associate	17764565, 19153073, 19799609, 20642860, 22695491, 22701537, 22765268, 24205493, 26452468, 28099918, 29203642, 33277842, 33899544, 35092367
Breast Neoplasms Male	Associate	22765268
Carcinogenesis	Associate	23736679, 25565774, 27516190, 33407434
Carcinoma Hepatocellular	Associate	18425332
Carcinoma Intraductal Noninfiltrating	Associate	25331261
Carcinoma Non Small Cell Lung	Associate	15042681, 16598760, 18286531, 18337602, 18349282, 22169480, 24998565, 25565774, 32238407
Carcinoma Renal Cell	Associate	33761933
Carcinoma Squamous Cell	Inhibit	12177241, 15816843, 17573778
Carcinoma Squamous Cell	Associate	22592160
Carcinoma Transitional Cell	Associate	21672320
Cardiovascular Diseases	Associate	21617638, 21771975
Carotid Artery Diseases	Associate	24142632
Cerebral Infarction	Associate	21771975, 28245897
Cerebral Palsy	Associate	33557955
Cholangiocarcinoma	Associate	22446083
Cognition Disorders	Associate	34573337
Colitis Ulcerative	Associate	25303049
Colonic Neoplasms	Associate	33818827
Colorectal Neoplasms	Associate	14997203, 16475679, 21796503, 22034905, 22132162, 26362652, 26862732, 33818827
Colorectal Neoplasms	Inhibit	15292927
Coronary Aneurysm	Associate	26446643
Coronary Artery Disease	Associate	25543204, 28584231
Death	Associate	25015764
Depressive Disorder	Associate	22064162
Depressive Disorder Major	Associate	34573337
Developmental Disabilities	Associate	33486346
Diabetes Gestational	Associate	35689735
Diabetes Mellitus	Associate	28245897
Diabetes Mellitus Type 2	Associate	21771975, 24688318
Diabetic Nephropathies	Associate	36401196
Diabetic Retinopathy	Associate	30882695
Digestive System Neoplasms	Associate	15292927
Disease	Associate	22701537
Dystonia	Associate	33557955
Emphysema	Associate	25306249
Endometrial Hyperplasia	Associate	36628559
Endometrial Neoplasms	Associate	16928264, 23736679, 31787246, 36232772
Endometriosis	Associate	34794738
Epilepsy Rolandic	Associate	22738016
Esophageal Neoplasms	Associate	27506957
Esophageal Squamous Cell Carcinoma	Associate	15292927, 17094449, 18729198
Esophagitis	Associate	18729198
Fetal Diseases	Associate	36585686
Fibrosis	Associate	12433278
Gallbladder Neoplasms	Associate	19116147
Glaucoma	Associate	33114701
Glioblastoma	Associate	19809523, 34080022
Glioma	Associate	18425332
Glomerulonephritis Membranous	Associate	25349169
Glucosephosphate Dehydrogenase Deficiency	Associate	25677060
Heart Diseases	Associate	35499926
Hyperlipidemias	Associate	22369086
Hyperplasia	Associate	36628559
Hypertension	Associate	19304780, 21771975, 24142632
Hypoadiponectinemia	Associate	21617638, 35002951
Inflammation	Associate	25127211, 26114387, 28355295
Insulin Resistance	Associate	24009259, 26423718
Language Disorders	Associate	20963441
Leukemia	Associate	18523155
Leukemia Myeloid Acute	Associate	18523155, 24164743
Lung Neoplasms	Associate	17960794, 22169480, 25735345, 30516882, 32570854
Lymphatic Metastasis	Associate	20642860, 25685297
Melanoma	Associate	15526363, 23069940
Mental Disorders	Associate	23358160, 25349169, 33486346, 34573337
Metabolic Syndrome	Associate	21771975, 25543204, 25875811, 26423718, 34759445
Motor Neuron Disease	Associate	33557955
Myocardial Infarction	Associate	22369086
Nasopharyngeal Carcinoma	Associate	21535891
Neoplasm Metastasis	Inhibit	18425332
Neoplasm Metastasis	Associate	21731750
Neoplasms	Associate	12433278, 14997203, 16532039, 17094449, 17623056, 17765896, 17873891, 18286531, 18337602, 18349282, 19764999, 19799609, 19809523, 20371677, 20642860 View all (11 more)
Neoplasms	Inhibit	15292927, 17764565, 18425332, 21672320, 21796503, 22592160, 22701537, 23069940, 24252461, 25196672, 25565774, 32466334, 33407434, 33818827
Neuroblastoma	Associate	10737605
Non Muscle Invasive Bladder Neoplasms	Associate	25196672
Obesity	Associate	21617638, 33983957, 34716426, 36232772
Ovarian Neoplasms	Associate	22871047, 23438850, 30368729
Overweight	Associate	34716426
Pancreatic Neoplasms	Associate	15245595
Parkinson Disease	Associate	24998565
Pituitary Neoplasms	Associate	17873891
Pre Eclampsia	Associate	23976997
Prostatic Neoplasms	Associate	18387661, 21694441, 25015764, 25685297, 30204798
Psoriasis	Inhibit	15816843
Pulmonary Disease Chronic Obstructive	Associate	26806298, 32234053
Retinoblastoma	Associate	22278416
Schizophrenia	Associate	23358160, 39999946
Seizures	Associate	33557955
Sinonasal undifferentiated carcinoma	Associate	27516190
Smoke Inhalation Injury	Associate	21617638
Squamous Cell Carcinoma of Head and Neck	Associate	25065733, 25147921
Stomach Neoplasms	Associate	15292927
Thyroid Carcinoma Anaplastic	Associate	17406368
Triple Negative Breast Neoplasms	Associate	17764565, 25684485
Tuberculosis Pulmonary	Associate	28355295
Urinary Bladder Neoplasms	Associate	25196672, 29854012
Uterine Cervical Neoplasms	Associate	17971771, 22942707, 28120872
Uterine Cervicitis	Associate	34991696
Vascular Remodeling	Associate	19038053
Ventricular Dysfunction Left	Associate	26556563

CDH13 (cadherin 13)