Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10112
Gene name	Kinesin family member 20A
Gene symbol	KIF20A
Synonyms (NCBI Gene)	MKLP2RAB6KIFLRCM6
Chromosome	5
Chromosome location	5q31.2

Show/Hide all (52)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023002	hsa-miR-124-3p	Proteomics	18668037
MIRT024718	hsa-miR-215-5p	Microarray	19074876
MIRT026859	hsa-miR-192-5p	Microarray	19074876
MIRT050411	hsa-miR-23a-3p	CLASH	23622248
MIRT049540	hsa-miR-92a-3p	CLASH	23622248
MIRT1093976	hsa-miR-1200	CLIP-seq
MIRT1093977	hsa-miR-1224-3p	CLIP-seq
MIRT1093978	hsa-miR-1266	CLIP-seq
MIRT1093979	hsa-miR-25	CLIP-seq
MIRT1093980	hsa-miR-3127-5p	CLIP-seq
MIRT1093981	hsa-miR-32	CLIP-seq
MIRT1093982	hsa-miR-3201	CLIP-seq
MIRT1093983	hsa-miR-324-5p	CLIP-seq
MIRT1093984	hsa-miR-363	CLIP-seq
MIRT1093985	hsa-miR-367	CLIP-seq
MIRT1093986	hsa-miR-3690	CLIP-seq
MIRT1093987	hsa-miR-374a	CLIP-seq
MIRT1093988	hsa-miR-374b	CLIP-seq
MIRT1093989	hsa-miR-3918	CLIP-seq
MIRT1093990	hsa-miR-410	CLIP-seq
MIRT1093991	hsa-miR-4254	CLIP-seq
MIRT1093992	hsa-miR-4311	CLIP-seq
MIRT1093993	hsa-miR-4422	CLIP-seq
MIRT1093994	hsa-miR-4518	CLIP-seq
MIRT1093995	hsa-miR-4682	CLIP-seq
MIRT1093996	hsa-miR-4791	CLIP-seq
MIRT1093997	hsa-miR-4793-5p	CLIP-seq
MIRT1093998	hsa-miR-496	CLIP-seq
MIRT1093999	hsa-miR-889	CLIP-seq
MIRT1094000	hsa-miR-92a	CLIP-seq
MIRT1094001	hsa-miR-92b	CLIP-seq
MIRT1094002	hsa-miR-942	CLIP-seq
MIRT2025194	hsa-miR-147	CLIP-seq
MIRT2025195	hsa-miR-153	CLIP-seq
MIRT2025196	hsa-miR-2113	CLIP-seq
MIRT1093979	hsa-miR-25	CLIP-seq
MIRT1093981	hsa-miR-32	CLIP-seq
MIRT1093982	hsa-miR-3201	CLIP-seq
MIRT1093983	hsa-miR-324-5p	CLIP-seq
MIRT1093984	hsa-miR-363	CLIP-seq
MIRT1093985	hsa-miR-367	CLIP-seq
MIRT1093986	hsa-miR-3690	CLIP-seq
MIRT1093991	hsa-miR-4254	CLIP-seq
MIRT2025197	hsa-miR-452	CLIP-seq
MIRT2025198	hsa-miR-4676-3p	CLIP-seq
MIRT1093995	hsa-miR-4682	CLIP-seq
MIRT1093996	hsa-miR-4791	CLIP-seq
MIRT1093997	hsa-miR-4793-5p	CLIP-seq
MIRT1093998	hsa-miR-496	CLIP-seq
MIRT2025199	hsa-miR-599	CLIP-seq
MIRT1094000	hsa-miR-92a	CLIP-seq
MIRT1094001	hsa-miR-92b	CLIP-seq

Show/Hide all (32)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000281	Process	Mitotic cytokinesis	IMP	15843429
GO:0001578	Process	Microtubule bundle formation	IDA	12939256
GO:0003777	Function	Microtubule motor activity	IBA
GO:0003777	Function	Microtubule motor activity	IEA
GO:0005515	Function	Protein binding	IPI	16431929, 25416956, 31515488
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005794	Component	Golgi apparatus	IEA
GO:0005819	Component	Spindle	IDA	12939256
GO:0005819	Component	Spindle	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005871	Component	Kinesin complex	IBA
GO:0005874	Component	Microtubule	IBA
GO:0005874	Component	Microtubule	IEA
GO:0007018	Process	Microtubule-based movement	IBA
GO:0007018	Process	Microtubule-based movement	IEA
GO:0008017	Function	Microtubule binding	IBA
GO:0008017	Function	Microtubule binding	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016887	Function	ATP hydrolysis activity	IBA
GO:0019901	Function	Protein kinase binding	IPI	12939256
GO:0030496	Component	Midbody	IDA	15843429
GO:0032154	Component	Cleavage furrow	IDA
GO:0032465	Process	Regulation of cytokinesis	IDA	12939256
GO:0045171	Component	Intercellular bridge	IDA
GO:0061952	Process	Midbody abscission	IMP	15843429
GO:0072686	Component	Mitotic spindle	IDA

MIM	HGNC	e!Ensembl
605664	9787	ENSG00000112984

O95235

Protein name

Kinesin-like protein KIF20A (GG10_2) (Mitotic kinesin-like protein 2) (MKlp2) (Rab6-interacting kinesin-like protein) (Rabkinesin-6)

Protein function

Mitotic kinesin required for chromosome passenger complex (CPC)-mediated cytokinesis. Following phosphorylation by PLK1, involved in recruitment of PLK1 to the central spindle. Interacts with guanosine triphosphate (GTP)-bound forms of RAB6A and

PDB

6YIP

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00225	Kinesin	70 → 507	Kinesin motor domain	Domain

Sequence

MSQGILSPPAGLLSDDDVVVSPMFESTAADLGSVVRKNLLSDCSVVSTSLEDKQQVPSED
SMEKVKVYLRVRPLLPSELERQEDQGCVRIENVETLVLQAPKDSFALKSNERGIGQATHR
FTFSQIFGPEVGQASFFNLTVKEMVKDVLKGQNWLIYTYGVTNSGKTHTIQGTIKDGGIL
PRSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKLSLLNGGLQEEELSTS
LKRSVYIESRIGTSTSFDSGIAGLSSISQCTSSSQLDETSHRWAQPDTAPLPVPANIRFS
IWISFFEIYNELLYDLLEPPSQQRKRQTLRLCEDQNGNPYVKDLNWIHVQDAEEAWKLLK
VGRKNQSFASTHLNQNSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSERCKDQKS
GERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLVPFRDSKLTRVFQGFFTGRGRSCM
IVNVNPCASTYDETLHVAKFSAIASQLVHAPPMQLGFPSLHSFIKEHSLQVSPSLEKGAK
ADTGLDDDIENEADISMYGKEELLQVVEAMKTLLLKERQEKLQLEMHLRDEICNEMVEQM
QQREQWCSEHLDTQKELLEEMYEEKLNILKESLTSFYQEEIQERDEKIEELEALLQEARQ
QSVAHQQSGSELALRRSQRLAASASTQQLQEVKAKLQQCKAELNSTTEELHKYQKMLEPP
PSAKPFTIDVDKKLEEGQKNIRLLRTELQKLGESLQSAERACCHSTGAGKLRQALTTCDD
ILIKQDQTLAELQNNMVLVKLDLRKKAACIAEQYHTVLKLQGQVSAKKRLGTNQENQQPN
QQPPGKKPFLRNLLPRTPTCQSSTDCSPYARILRSRRSPLLKSGPFGKKY

Sequence length

890

Interactions

View interactions

	KEGG		Reactome
	Motor proteins		MHC class II antigen presentation COPI-dependent Golgi-to-ER retrograde traffic Mitotic Telophase/Cytokinesis Kinesins

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Cardiomyopathy, familial restrictive, 6	Pathogenic	rs2151233812	RCV001535816

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Cervical cancer	Likely benign	rs375123506	RCV005925988
Clear cell carcinoma of kidney	Benign	rs201784256	RCV005922905
Colon adenocarcinoma	Benign	rs140512754	RCV005871273
Familial cancer of breast	Benign	rs140512754	RCV005871272
Gastric cancer	Uncertain significance; Benign	rs565096672, rs140512754	RCV005926737 RCV005871274
KIF20A-related disorder	Likely benign	rs142562832	RCV003958897
Malignant tumor of urinary bladder	Uncertain significance	rs765678263	RCV005935075
Ovarian serous cystadenocarcinoma	Benign	rs201784256	RCV005922906
Thymoma	Uncertain significance	rs148685779	RCV005922849
Uterine carcinosarcoma	Benign	rs141701454	RCV005928268
Uterine corpus endometrial carcinoma	Benign	rs140512754	RCV005871275

Show/Hide Text Mining Associations (46)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Acute Aortic Syndrome	Associate	31721906
Adenocarcinoma of Lung	Associate	31322267, 35810236, 36524130, 37322027, 37752167, 38281298
Aortic Dissection	Associate	31721906
Breast Neoplasms	Stimulate	24391143
Breast Neoplasms	Associate	30593585, 31895772, 34384030, 36930083
Carcinogenesis	Associate	28901457, 32695240
Carcinoma Hepatocellular	Associate	28901457, 29500859, 31811111, 32046048, 32382568, 32722976, 33102593, 33736645, 33784984, 34112092, 34315286, 34491228, 34746301, 35123420, 35322101, 36120772, 38052560 View all (2 more)
Carcinoma Non Small Cell Lung	Associate	31775549, 33126319
Carcinoma Ovarian Epithelial	Associate	33726773, 36768616
Carcinoma Renal Cell	Associate	29749467, 33232285, 33287763, 33836688, 36637953, 37310408
Carcinoma Squamous Cell	Associate	27941992
Cardiomyopathies	Associate	29357359
Cardiomyopathy Restrictive	Associate	29357359
Colorectal Neoplasms	Stimulate	32695240
COVID 19	Associate	35749386
Death	Associate	29500859
Fibrosis	Associate	31811111
Glioblastoma	Associate	34018447
Glioma	Associate	35774141, 37248320, 37744243
Hepatitis B	Associate	33102593
Inflammation	Associate	37310408
Intervertebral Disc Degeneration	Associate	34545328
Kidney Neoplasms	Associate	36637953
Kidney Neoplasms	Stimulate	37310408
Leukemia Myeloid Acute	Associate	33579308
Lymphatic Metastasis	Stimulate	27941992, 32695240
Melanoma	Associate	22854760, 34659201
Mesothelioma Malignant	Associate	33032291, 36523602
Nasopharyngeal Carcinoma	Associate	28081138
Nasopharyngeal Neoplasms	Associate	28081138
Neoplasm Metastasis	Associate	28081138, 31871312
Neoplasm Metastasis	Stimulate	31093305, 32695240
Neoplasms	Associate	24391143, 27941992, 28052097, 28081138, 29500859, 29749467, 31571332, 32695240, 33232285, 34315286, 34556750, 34728699, 34746301, 37248320
Neoplasms	Stimulate	36637953
Osteosarcoma	Associate	29760609, 39324133
Ovarian Neoplasms	Associate	29749467, 31871312
Pancreatic Neoplasms	Associate	22854760, 25499221
Papillomavirus Infections	Associate	27941992
Prostatic Neoplasms	Associate	34198380
Prostatic Neoplasms Castration Resistant	Stimulate	35418689
Protein S Deficiency	Associate	38052560
Pyruvate Carboxylase Deficiency Disease	Associate	35418689
Retinoblastoma	Associate	33217867
Stomach Neoplasms	Associate	21931799
Urinary Bladder Neoplasms	Associate	31093305, 36637953, 37310408
Uterine Cervical Neoplasms	Associate	27941992

KIF20A (kinesin family member 20A)