Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10110
Gene name Gene Name - the full gene name approved by the HGNC.	Serum/glucocorticoid regulated kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SGK2
Synonyms (NCBI Gene) Gene synonyms aliases	H-SGK2, dJ138B7.2
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q13.12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that ac

Show/Hide all(16)

miRTarBase ID	miRNA	Experiments
MIRT2101414	hsa-miR-3124-3p	CLIP-seq
MIRT2101415	hsa-miR-3127-3p	CLIP-seq
MIRT2325779	hsa-miR-1207-5p	CLIP-seq
MIRT2325780	hsa-miR-1273f	CLIP-seq
MIRT2325781	hsa-miR-143	CLIP-seq
MIRT2325782	hsa-miR-298	CLIP-seq
MIRT2325783	hsa-miR-3174	CLIP-seq
MIRT2325784	hsa-miR-3606	CLIP-seq
MIRT2325785	hsa-miR-4436b-3p	CLIP-seq
MIRT2325786	hsa-miR-4708-5p	CLIP-seq
MIRT2325787	hsa-miR-4736	CLIP-seq
MIRT2325788	hsa-miR-4761-5p	CLIP-seq
MIRT2325789	hsa-miR-4763-3p	CLIP-seq
MIRT2325790	hsa-miR-4770	CLIP-seq
MIRT2325791	hsa-miR-671-5p	CLIP-seq
MIRT2325792	hsa-miR-921	CLIP-seq

Show/Hide all(18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	TAS	20919962
GO:0004674	Function	Protein serine/threonine kinase activity	IBA	21873635
GO:0005524	Function	ATP binding	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	NAS	12397388
GO:0006979	Process	Response to oxidative stress	TAS	10548550
GO:0015459	Function	Potassium channel regulator activity	IBA	21873635
GO:0015459	Function	Potassium channel regulator activity	IDA	12397388
GO:0017080	Function	Sodium channel regulator activity	NAS	12632189
GO:0017080	Function	Sodium channel regulator activity	TAS	16460280
GO:0018105	Process	Peptidyl-serine phosphorylation	IBA	21873635
GO:0032411	Process	Positive regulation of transporter activity	TAS	16460280
GO:0034220	Process	Ion transmembrane transport	TAS
GO:0035556	Process	Intracellular signal transduction	IBA	21873635
GO:0042127	Process	Regulation of cell population proliferation	TAS	20919962
GO:0106310	Function	Protein serine kinase activity	IEA
GO:0106311	Function	Protein threonine kinase activity	IEA

MIM	HGNC	e!Ensembl
607589	13900	ENSG00000101049

Protein

UniProt ID

Q9HBY8

Protein name

Serine/threonine-protein kinase Sgk2 (EC 2.7.11.1) (Serum/glucocorticoid-regulated kinase 2)

Protein function

Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cell growth, survival and proliferation. Up-regulates Na(+) channels: SCNN1A/ENAC, K(+) channels: KCNA3/Kv1.3, KCNE1 an

Family and domains

Pfam

Warning: Undefined array key 372 in /var/www/html/new_GgeneT.php on line 1321

Warning: Undefined array key 416 in /var/www/html/new_GgeneT.php on line 1322

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	95 → 352	Protein kinase domain	Domain
PF00433	Pkinase_C	373 → 417	Protein kinase C terminal domain	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver, kidney and pancreas, and at lower levels in brain. {ECO:0000269|PubMed:10548550}.

Sequence

MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAF
YAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGE
LFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGL
CKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVS
QMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDL
YHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPE
DDDILDC

Sequence length

367

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway PI3K-Akt signaling pathway		Stimuli-sensing channels

Show/Hide Causal Diseases (1)

Disease term	Disease name	dbSNP ID	References
Causal
Lung adenocarcinoma	Adenocarcinoma of lung (disorder)	rs28934576, rs121913530, rs397516975, rs587776805, rs121913469, rs121913364, rs121913351, rs121913366, rs397516896, rs397516977, rs397516981, rs397517127, rs121913344, rs727504233, rs121913370 View all (5 more)

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text Mining
Adenocarcinoma of Lung	Associate	32998690
Carcinoma Hepatocellular	Associate	28639896, 35655171
Carcinoma Renal Cell	Associate	31002126
Drug Related Side Effects and Adverse Reactions	Associate	23681825
Kidney Neoplasms	Associate	31002126
Microvillus inclusion disease	Associate	37643022
Neoplasm Metastasis	Associate	33783250
Neoplasms	Associate	29975213, 32689909, 33783250
Non alcoholic Fatty Liver Disease	Associate	35655171
Prostatic Neoplasms	Stimulate	36720852
Shwachman Diamond Syndrome	Associate	30585299
Uterine Cervical Neoplasms	Associate	25615606
Virus Diseases	Associate	35655171

SGK2 (serum/glucocorticoid regulated kinase 2)