Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10110
Gene name Gene Name - the full gene name approved by the HGNC.	Serum/glucocorticoid regulated kinase 2
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	SGK2
Synonyms (NCBI Gene) Gene synonyms aliases	H-SGK2, dJ138B7.2
Chromosome Chromosome number	20
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	20q13.12
Summary Summary of gene provided in NCBI Entrez Gene.	This gene encodes a serine/threonine protein kinase. Although this gene product is similar to serum- and glucocorticoid-induced protein kinase (SGK), this gene is not induced by serum or glucocorticoids. This gene is induced in response to signals that ac

Show/Hide all(16)

miRTarBase ID	miRNA	Experiments
MIRT2101414	hsa-miR-3124-3p	CLIP-seq
MIRT2101415	hsa-miR-3127-3p	CLIP-seq
MIRT2325779	hsa-miR-1207-5p	CLIP-seq
MIRT2325780	hsa-miR-1273f	CLIP-seq
MIRT2325781	hsa-miR-143	CLIP-seq
MIRT2325782	hsa-miR-298	CLIP-seq
MIRT2325783	hsa-miR-3174	CLIP-seq
MIRT2325784	hsa-miR-3606	CLIP-seq
MIRT2325785	hsa-miR-4436b-3p	CLIP-seq
MIRT2325786	hsa-miR-4708-5p	CLIP-seq
MIRT2325787	hsa-miR-4736	CLIP-seq
MIRT2325788	hsa-miR-4761-5p	CLIP-seq
MIRT2325789	hsa-miR-4763-3p	CLIP-seq
MIRT2325790	hsa-miR-4770	CLIP-seq
MIRT2325791	hsa-miR-671-5p	CLIP-seq
MIRT2325792	hsa-miR-921	CLIP-seq

Show/Hide all(29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001558	Process	Regulation of cell growth	IEA
GO:0001558	Process	Regulation of cell growth	TAS	20919962
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IBA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	TAS	10548550
GO:0005515	Function	Protein binding	IPI	22939624, 32296183, 32707033, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006468	Process	Protein phosphorylation	NAS	12397388
GO:0006468	Process	Protein phosphorylation	TAS	10548550
GO:0006979	Process	Response to oxidative stress	TAS	10548550
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	IDA	12397388
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0017080	Function	Sodium channel regulator activity	IEA
GO:0017080	Function	Sodium channel regulator activity	NAS	12632189
GO:0017080	Function	Sodium channel regulator activity	TAS	16460280
GO:0032411	Process	Positive regulation of transporter activity	TAS	16460280
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0035556	Process	Intracellular signal transduction	TAS	10548550
GO:0042127	Process	Regulation of cell population proliferation	IEA
GO:0042127	Process	Regulation of cell population proliferation	TAS	20919962
GO:0106310	Function	Protein serine kinase activity	IEA

MIM	HGNC	e!Ensembl
607589	13900	ENSG00000101049

Protein

UniProt ID

Q9HBY8

Protein name

Serine/threonine-protein kinase Sgk2 (EC 2.7.11.1) (Serum/glucocorticoid-regulated kinase 2)

Protein function

Serine/threonine-protein kinase which is involved in the regulation of a wide variety of ion channels, membrane transporters, cell growth, survival and proliferation. Up-regulates Na(+) channels: SCNN1A/ENAC, K(+) channels: KCNA3/Kv1.3, KCNE1 an

Family and domains

Pfam

Warning: Undefined array key 372 in /var/www/html/new_GgeneT.php on line 1416

Warning: Undefined array key 416 in /var/www/html/new_GgeneT.php on line 1417

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	95 → 352	Protein kinase domain	Domain
PF00433	Pkinase_C	373 → 417	Protein kinase C terminal domain	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver, kidney and pancreas, and at lower levels in brain. {ECO:0000269|PubMed:10548550}.

Sequence

MNSSPAGTPSPQPSRANGNINLGPSANPNAQPTDFDFLKVIGKGNYGKVLLAKRKSDGAF
YAVKVLQKKSILKKKEQSHIMAERSVLLKNVRHPFLVGLRYSFQTPEKLYFVLDYVNGGE
LFFHLQRERRFLEPRARFYAAEVASAIGYLHSLNIIYRDLKPENILLDCQGHVVLTDFGL
CKEGVEPEDTTSTFCGTPEYLAPEVLRKEPYDRAVDWWCLGAVLYEMLHGLPPFYSQDVS
QMYENILHQPLQIPGGRTVAACDLLQSLLHKDQRQRLGSKADFLEIKNHVFFSPINWDDL
YHKRLTPPFNPNVTGPADLKHFDPEFTQEAVSKSIGCTPDTVASSSGASSAFLGFSYAPE
DDDILDC

Sequence length

367

Interactions

View interactions

	KEGG		Reactome
	FoxO signaling pathway PI3K-Akt signaling pathway		Stimuli-sensing channels

SGK2 (serum/glucocorticoid regulated kinase 2)