PYURF (PIGY upstream open reading frame)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
100996939
Gene name Gene Name - the full gene name approved by the HGNC.
PIGY upstream open reading frame
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PYURF
Synonyms (NCBI Gene) Gene synonyms aliases
NDUFAFQ, PREY
Chromosome Chromosome number
4
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
4q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
The product of this gene, which is well-conserved, is encoded by the same bicistronic transcript that encodes phosphatidylinositol glycan anchor biosynthesis, class Y, but the two proteins are unrelated. This gene represents the protein encoded by the ups
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(20)
miRTarBase ID miRNA Experiments Reference
MIRT555063 hsa-miR-31-5p PAR-CLIP 21572407
MIRT555062 hsa-miR-548e-5p PAR-CLIP 21572407
MIRT555061 hsa-miR-6757-3p PAR-CLIP 21572407
MIRT555060 hsa-miR-2278 PAR-CLIP 21572407
MIRT555058 hsa-miR-4690-5p PAR-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0000506 Component Glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex IBA 21873635
GO:0000506 Component Glycosylphosphatidylinositol-N-acetylglucosaminyltransferase (GPI-GnT) complex IDA 16162815
GO:0005515 Function Protein binding IPI 16162815
GO:0005739 Component Mitochondrion IEA
GO:0005789 Component Endoplasmic reticulum membrane IDA 16162815
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
619956 44317 ENSG00000145337
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q96I23
Protein name Protein preY, mitochondrial (PIGY upstream reading frame protein)
Protein function In mitochondria, S-adenosylmethionine-dependent methyltransferase chaperone that supports both coenzyme Q biosynthesis, by stabilizing its components, such as COQ5, and NADH:ubiquinone oxidoreductase complex (complex I, MT-ND1) assembly, by stab
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF03966 Trm112p 51 → 90 Trm112p-like protein Domain
Sequence 
MLSGARCRLASALRGTRAPPSAVARRCLHASGSRPLADRGKKTEEPPRDFDPALLEFLVC
PLSKKPLRYEASTNELINEELGIAYPIIDGIPNMIPQAARMTRQSKKQEEVEQR
Sequence length 114
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Hyperphosphatasia with mental retardation HYPERPHOSPHATASIA WITH MENTAL RETARDATION SYNDROME 6 rs139073416, rs267606951, rs267606952, rs387907023, rs142164373, rs770591449, rs368953604, rs879255232, rs774843232, rs773359554, rs587776970, rs587777251, rs587777252, rs371549948, rs587777733
View all (45 more)
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Glioblastoma Glioblastoma CRISPR screening of E3 ubiquitin ligases reveals Ring Finger Protein 185 as a novel tumor suppressor in glioblastoma repressed by promoter hypermethylation and miR-587 GWAS, CBGDA
Show/Hide Text Mining Associations (1)
Associations from Text Mining
Disease Name Relationship Type References
Mitochondrial Diseases Associate 35614220