Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	1009
Gene name	Cadherin 11
Gene symbol	CDH11
Synonyms (NCBI Gene)	CAD11CDHOBESWSOBOSF-4TBHS2
Chromosome	16
Chromosome location	16q21
Summary	This gene encodes a type II classical cadherin from the cadherin superfamily, integral membrane proteins that mediate calcium-dependent cell-cell adhesion. Mature cadherin proteins are composed of a large N-terminal extracellular domain, a single membrane

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1555514463	AG>CTGATGATC	Pathogenic	Frameshift variant, coding sequence variant
rs1555515331	C>A	Pathogenic	Splice donor variant
rs1555515924	G>C	Pathogenic	Stop gained, coding sequence variant

215

Show/Hide all (215)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018564	hsa-miR-335-5p	Microarray	18185580
MIRT022977	hsa-miR-124-3p	Microarray	18668037
MIRT054102	hsa-miR-200c-3p	ImmunohistochemistryLuciferase reporter assayMicroarrayQRTPCR	23497265
MIRT732299	hsa-miR-27b-3p	Luciferase reporter assayqRT-PCRWestern blot	26706910
MIRT732299	hsa-miR-27b-3p	Luciferase reporter assayqRT-PCRWestern blot	26706910
MIRT735017	hsa-miR-181a-5p	qRT-PCR	33102604
MIRT736395	hsa-miR-127-3p	Luciferase reporter assayWestern blottingqRT-PCR	33574696
MIRT879295	hsa-miR-101	CLIP-seq
MIRT879296	hsa-miR-1206	CLIP-seq
MIRT879297	hsa-miR-127-5p	CLIP-seq
MIRT879298	hsa-miR-1279	CLIP-seq
MIRT879299	hsa-miR-128	CLIP-seq
MIRT879300	hsa-miR-144	CLIP-seq
MIRT879301	hsa-miR-151-3p	CLIP-seq
MIRT879302	hsa-miR-200b	CLIP-seq
MIRT879303	hsa-miR-200c	CLIP-seq
MIRT879304	hsa-miR-204	CLIP-seq
MIRT879305	hsa-miR-205	CLIP-seq
MIRT879306	hsa-miR-211	CLIP-seq
MIRT879307	hsa-miR-2113	CLIP-seq
MIRT879308	hsa-miR-223	CLIP-seq
MIRT879309	hsa-miR-27a	CLIP-seq
MIRT879310	hsa-miR-27b	CLIP-seq
MIRT879311	hsa-miR-3141	CLIP-seq
MIRT879312	hsa-miR-3143	CLIP-seq
MIRT879313	hsa-miR-3145-3p	CLIP-seq
MIRT879314	hsa-miR-3152-5p	CLIP-seq
MIRT879315	hsa-miR-3161	CLIP-seq
MIRT879316	hsa-miR-3163	CLIP-seq
MIRT879317	hsa-miR-3662	CLIP-seq
MIRT879318	hsa-miR-376c	CLIP-seq
MIRT879319	hsa-miR-4277	CLIP-seq
MIRT879320	hsa-miR-4279	CLIP-seq
MIRT879321	hsa-miR-4289	CLIP-seq
MIRT879322	hsa-miR-429	CLIP-seq
MIRT879323	hsa-miR-4420	CLIP-seq
MIRT879324	hsa-miR-4422	CLIP-seq
MIRT879325	hsa-miR-4446-5p	CLIP-seq
MIRT879326	hsa-miR-4666-5p	CLIP-seq
MIRT879327	hsa-miR-4678	CLIP-seq
MIRT879328	hsa-miR-4697-3p	CLIP-seq
MIRT879329	hsa-miR-4699-3p	CLIP-seq
MIRT879330	hsa-miR-4709-5p	CLIP-seq
MIRT879331	hsa-miR-4755-5p	CLIP-seq
MIRT879332	hsa-miR-4774-3p	CLIP-seq
MIRT879333	hsa-miR-494	CLIP-seq
MIRT879334	hsa-miR-513a-5p	CLIP-seq
MIRT879335	hsa-miR-539	CLIP-seq
MIRT879336	hsa-miR-543	CLIP-seq
MIRT879337	hsa-miR-548c-3p	CLIP-seq
MIRT879338	hsa-miR-548m	CLIP-seq
MIRT879339	hsa-miR-595	CLIP-seq
MIRT879340	hsa-miR-600	CLIP-seq
MIRT879341	hsa-miR-623	CLIP-seq
MIRT879342	hsa-miR-758	CLIP-seq
MIRT879295	hsa-miR-101	CLIP-seq
MIRT879296	hsa-miR-1206	CLIP-seq
MIRT879299	hsa-miR-128	CLIP-seq
MIRT879300	hsa-miR-144	CLIP-seq
MIRT879309	hsa-miR-27a	CLIP-seq
MIRT879310	hsa-miR-27b	CLIP-seq
MIRT1546367	hsa-miR-2964a-5p	CLIP-seq
MIRT879312	hsa-miR-3143	CLIP-seq
MIRT879316	hsa-miR-3163	CLIP-seq
MIRT1546368	hsa-miR-3183	CLIP-seq
MIRT1546369	hsa-miR-3607-3p	CLIP-seq
MIRT1546370	hsa-miR-3686	CLIP-seq
MIRT1546371	hsa-miR-3713	CLIP-seq
MIRT1546372	hsa-miR-3909	CLIP-seq
MIRT1546373	hsa-miR-4328	CLIP-seq
MIRT1546374	hsa-miR-4477a	CLIP-seq
MIRT879327	hsa-miR-4678	CLIP-seq
MIRT879329	hsa-miR-4699-3p	CLIP-seq
MIRT879330	hsa-miR-4709-5p	CLIP-seq
MIRT1546375	hsa-miR-4723-3p	CLIP-seq
MIRT879334	hsa-miR-513a-5p	CLIP-seq
MIRT879336	hsa-miR-543	CLIP-seq
MIRT879338	hsa-miR-548m	CLIP-seq
MIRT879339	hsa-miR-595	CLIP-seq
MIRT879300	hsa-miR-144	CLIP-seq
MIRT879313	hsa-miR-3145-3p	CLIP-seq
MIRT1960644	hsa-miR-3658	CLIP-seq
MIRT879319	hsa-miR-4277	CLIP-seq
MIRT1960645	hsa-miR-4426	CLIP-seq
MIRT1960646	hsa-miR-4647	CLIP-seq
MIRT1960647	hsa-miR-4662b	CLIP-seq
MIRT879329	hsa-miR-4699-3p	CLIP-seq
MIRT1960648	hsa-miR-548p	CLIP-seq
MIRT1960649	hsa-miR-564	CLIP-seq
MIRT879302	hsa-miR-200b	CLIP-seq
MIRT879303	hsa-miR-200c	CLIP-seq
MIRT879322	hsa-miR-429	CLIP-seq
MIRT879323	hsa-miR-4420	CLIP-seq
MIRT879326	hsa-miR-4666-5p	CLIP-seq
MIRT879333	hsa-miR-494	CLIP-seq
MIRT879340	hsa-miR-600	CLIP-seq
MIRT879296	hsa-miR-1206	CLIP-seq
MIRT879299	hsa-miR-128	CLIP-seq
MIRT2427228	hsa-miR-1297	CLIP-seq
MIRT879300	hsa-miR-144	CLIP-seq
MIRT2427229	hsa-miR-198	CLIP-seq
MIRT879302	hsa-miR-200b	CLIP-seq
MIRT879303	hsa-miR-200c	CLIP-seq
MIRT879307	hsa-miR-2113	CLIP-seq
MIRT2427230	hsa-miR-214	CLIP-seq
MIRT2427231	hsa-miR-2355-3p	CLIP-seq
MIRT2427232	hsa-miR-26a	CLIP-seq
MIRT2427233	hsa-miR-26b	CLIP-seq
MIRT879309	hsa-miR-27a	CLIP-seq
MIRT879310	hsa-miR-27b	CLIP-seq
MIRT1546367	hsa-miR-2964a-5p	CLIP-seq
MIRT879312	hsa-miR-3143	CLIP-seq
MIRT879316	hsa-miR-3163	CLIP-seq
MIRT2427234	hsa-miR-3619-5p	CLIP-seq
MIRT1546372	hsa-miR-3909	CLIP-seq
MIRT2427235	hsa-miR-3976	CLIP-seq
MIRT2427236	hsa-miR-4263	CLIP-seq
MIRT879319	hsa-miR-4277	CLIP-seq
MIRT879322	hsa-miR-429	CLIP-seq
MIRT2427237	hsa-miR-4291	CLIP-seq
MIRT1546373	hsa-miR-4328	CLIP-seq
MIRT2427238	hsa-miR-4427	CLIP-seq
MIRT2427239	hsa-miR-4465	CLIP-seq
MIRT1546374	hsa-miR-4477a	CLIP-seq
MIRT2427240	hsa-miR-4477b	CLIP-seq
MIRT879326	hsa-miR-4666-5p	CLIP-seq
MIRT879327	hsa-miR-4678	CLIP-seq
MIRT879329	hsa-miR-4699-3p	CLIP-seq
MIRT2427241	hsa-miR-4735-5p	CLIP-seq
MIRT2427242	hsa-miR-4775	CLIP-seq
MIRT2427243	hsa-miR-498	CLIP-seq
MIRT879334	hsa-miR-513a-5p	CLIP-seq
MIRT2427244	hsa-miR-520a-5p	CLIP-seq
MIRT2427245	hsa-miR-524-3p	CLIP-seq
MIRT2427246	hsa-miR-525-3p	CLIP-seq
MIRT2427247	hsa-miR-525-5p	CLIP-seq
MIRT879335	hsa-miR-539	CLIP-seq
MIRT879336	hsa-miR-543	CLIP-seq
MIRT879337	hsa-miR-548c-3p	CLIP-seq
MIRT879338	hsa-miR-548m	CLIP-seq
MIRT2427248	hsa-miR-576-5p	CLIP-seq
MIRT2427249	hsa-miR-590-3p	CLIP-seq
MIRT879339	hsa-miR-595	CLIP-seq
MIRT879340	hsa-miR-600	CLIP-seq
MIRT2427250	hsa-miR-656	CLIP-seq
MIRT2427251	hsa-miR-676	CLIP-seq
MIRT879342	hsa-miR-758	CLIP-seq
MIRT2427252	hsa-miR-761	CLIP-seq
MIRT2427253	hsa-miR-802	CLIP-seq
MIRT2427254	hsa-miR-922	CLIP-seq
MIRT1960649	hsa-miR-564	CLIP-seq
MIRT1960644	hsa-miR-3658	CLIP-seq
MIRT1960645	hsa-miR-4426	CLIP-seq
MIRT1960646	hsa-miR-4647	CLIP-seq
MIRT1960647	hsa-miR-4662b	CLIP-seq
MIRT1960649	hsa-miR-564	CLIP-seq
MIRT2427228	hsa-miR-1297	CLIP-seq
MIRT2427232	hsa-miR-26a	CLIP-seq
MIRT2427233	hsa-miR-26b	CLIP-seq
MIRT2427239	hsa-miR-4465	CLIP-seq
MIRT2427243	hsa-miR-498	CLIP-seq
MIRT879337	hsa-miR-548c-3p	CLIP-seq
MIRT2427230	hsa-miR-214	CLIP-seq
MIRT2500587	hsa-miR-297	CLIP-seq
MIRT2500588	hsa-miR-3064-5p	CLIP-seq
MIRT2500589	hsa-miR-3115	CLIP-seq
MIRT2500590	hsa-miR-3126-3p	CLIP-seq
MIRT2500591	hsa-miR-3128	CLIP-seq
MIRT2500592	hsa-miR-3149	CLIP-seq
MIRT2500593	hsa-miR-320e	CLIP-seq
MIRT2500594	hsa-miR-335	CLIP-seq
MIRT2427234	hsa-miR-3619-5p	CLIP-seq
MIRT1960644	hsa-miR-3658	CLIP-seq
MIRT2427237	hsa-miR-4291	CLIP-seq
MIRT1960645	hsa-miR-4426	CLIP-seq
MIRT2427238	hsa-miR-4427	CLIP-seq
MIRT2500595	hsa-miR-4503	CLIP-seq
MIRT1960646	hsa-miR-4647	CLIP-seq
MIRT1960647	hsa-miR-4662b	CLIP-seq
MIRT2500596	hsa-miR-4720-5p	CLIP-seq
MIRT2500597	hsa-miR-4799-3p	CLIP-seq
MIRT879333	hsa-miR-494	CLIP-seq
MIRT1960648	hsa-miR-548p	CLIP-seq
MIRT1960649	hsa-miR-564	CLIP-seq
MIRT2500598	hsa-miR-629	CLIP-seq
MIRT2427250	hsa-miR-656	CLIP-seq
MIRT2427252	hsa-miR-761	CLIP-seq
MIRT2427253	hsa-miR-802	CLIP-seq
MIRT2427254	hsa-miR-922	CLIP-seq
MIRT2427230	hsa-miR-214	CLIP-seq
MIRT2500587	hsa-miR-297	CLIP-seq
MIRT2500588	hsa-miR-3064-5p	CLIP-seq
MIRT2500589	hsa-miR-3115	CLIP-seq
MIRT2500590	hsa-miR-3126-3p	CLIP-seq
MIRT2500591	hsa-miR-3128	CLIP-seq
MIRT2500592	hsa-miR-3149	CLIP-seq
MIRT2500593	hsa-miR-320e	CLIP-seq
MIRT2500594	hsa-miR-335	CLIP-seq
MIRT2427234	hsa-miR-3619-5p	CLIP-seq
MIRT1960644	hsa-miR-3658	CLIP-seq
MIRT2427237	hsa-miR-4291	CLIP-seq
MIRT1960645	hsa-miR-4426	CLIP-seq
MIRT2427238	hsa-miR-4427	CLIP-seq
MIRT2500595	hsa-miR-4503	CLIP-seq
MIRT1960646	hsa-miR-4647	CLIP-seq
MIRT1960647	hsa-miR-4662b	CLIP-seq
MIRT2500596	hsa-miR-4720-5p	CLIP-seq
MIRT2500597	hsa-miR-4799-3p	CLIP-seq
MIRT879333	hsa-miR-494	CLIP-seq
MIRT1960648	hsa-miR-548p	CLIP-seq
MIRT1960649	hsa-miR-564	CLIP-seq
MIRT2500598	hsa-miR-629	CLIP-seq
MIRT2427252	hsa-miR-761	CLIP-seq
MIRT2427253	hsa-miR-802	CLIP-seq
MIRT2427254	hsa-miR-922	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
AR	Unknown	20191612

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000902	Process	Cell morphogenesis	IBA
GO:0001501	Process	Skeletal system development	TAS	8163513
GO:0001503	Process	Ossification	NAS	8163513
GO:0003189	Process	Aortic valve formation	ISS	26188246
GO:0005509	Function	Calcium ion binding	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IBA
GO:0007043	Process	Cell-cell junction assembly	IBA
GO:0007155	Process	Cell adhesion	IEA
GO:0007155	Process	Cell adhesion	TAS	8163513
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IEA
GO:0008013	Function	Beta-catenin binding	IBA
GO:0016020	Component	Membrane	IEA
GO:0016339	Process	Calcium-dependent cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0016342	Component	Catenin complex	IBA
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	ISS	26188246
GO:0021957	Process	Corticospinal tract morphogenesis	IEA
GO:0030336	Process	Negative regulation of cell migration	IMP	33811546
GO:0031589	Process	Cell-substrate adhesion	IMP	33811546
GO:0034332	Process	Adherens junction organization	IBA
GO:0044331	Process	Cell-cell adhesion mediated by cadherin	IBA
GO:0045202	Component	Synapse	IEA
GO:0045296	Function	Cadherin binding	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0048041	Process	Focal adhesion assembly	IMP	33811546
GO:0050804	Process	Modulation of chemical synaptic transmission	IEA
GO:0070062	Component	Extracellular exosome	HDA	23533145
GO:0098609	Process	Cell-cell adhesion	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

MIM	HGNC	e!Ensembl
600023	1750	ENSG00000140937

P55287

Protein name

Cadherin-11 (OSF-4) (Osteoblast cadherin) (OB-cadherin)

Protein function

Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. Required for proper focal

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00028	Cadherin	59 → 150	Cadherin domain	Domain
PF00028	Cadherin	164 → 259	Cadherin domain	Domain
PF00028	Cadherin	273 → 375	Cadherin domain	Domain
PF00028	Cadherin	388 → 479	Cadherin domain	Domain
PF01049	Cadherin_C	641 → 789	Cadherin cytoplasmic region	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed mainly in brain but also found in other tissues. Expressed in neuroblasts. In the embryo from 67 to 72 days of gestation, detected at high levels in facial mesenchyme including the central palatal mesenchyme, dental mesenchym

Sequence

MKENYCLQAALVCLGMLCHSHAFAPERRGHLRPSFHGHHEKGKEGQVLQRSKRGWVWNQF
FVIEEYTGPDPVLVGRLHSDIDSGDGNIKYILSGEGAGTIFVIDDKSGNIHATKTLDREE
RAQYTLMAQAVDRDTNRPLEPPSEFIVKVQDINDNPPEFLHETYHANVPERSNVGTSVIQ
VTASDADDPTYGNSAKLVYSILEGQPYFSVEAQTGIIRTALPNMDREAKEEYHVVIQAKD
MGGHMGGLSGTTKVTITLTDVNDNPPKFPQSVYQMSVSEAAVPGEEVGRVKAKDPDIGEN
GLVTYNIVDGDGMESFEITTDYETQEGVIKLKKPVDFETKRAYSLKVEAANVHIDPKFIS
NGPFKDTVTVKISVEDADEPPMFLAPSYIHEVQENAAAGTVVGRVHAKDPDAANSPIRYS
IDRHTDLDRFFTINPEDGFIKTTKPLDREETAWLNITVFAAEIHNRHQEAKVPVAIRVLD
VNDNAPKFAAPYEGFICESDQTKPLSNQPIVTISADDKDDTANGPRFIFSLPPEIIHNPN
FTVRDNRDNTAGVYARRGGFSRQKQDLYLLPIVISDGGIPPMSSTNTLTIKVCGCDVNGA
LLSCNAEAYILNAGLSTGALIAILACIVILLVIVVLFVTLRRQKKEPLIVFEEEDVRENI
ITYDDEGGGEEDTEAFDIATLQNPDGINGFIPRKDIKPEYQYMPRPGLRPAPNSVDVDDF
INTRIQEADNDPTAPPYDSIQIYGYEGRGSVAGSLSSLESATTDSDLDYDYLQNWGPRFK
KLADLYGSKDTFDDDS

Sequence length

796

Interactions

View interactions

	Reactome
			Adherens junctions interactions

Show/Hide Causal Diseases (2)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Elsahy-Waters syndrome	Likely pathogenic; Pathogenic	rs2142492118, rs1555515331, rs1555514463, rs1555515924	RCV004785330 RCV003314254 RCV000626316 RCV000626317 RCV000626318
Teebi hypertelorism syndrome 2	Pathogenic; Likely pathogenic	rs2142480699, rs2142528709, rs1000294766, rs2142492118, rs2142459670, rs2142481275, rs2506893332	RCV001823799 RCV001823800 RCV001823801 RCV001823802 RCV001823803 RCV001823804 RCV003387444

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
CDH11-related disorder	Uncertain significance; Likely benign; Benign	rs1315953324, rs35145978, rs146428080, rs571457064, rs376269667, rs878989042, rs76181686	RCV003391585 RCV003921405 RCV003982458 RCV003911571 RCV003933870 RCV003922244 RCV003978982
Glioma susceptibility 1	Uncertain significance	rs779648442	RCV005930819
Orofacial cleft 1	Uncertain significance	rs34181449	RCV003321461
Oromandibular-limb hypogenesis spectrum	Likely benign	rs200234049, rs757142171	RCV000240310 RCV000239988

Show/Hide Text Mining Associations (86)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
abc disease	Associate	15509545
Adenocarcinoma	Associate	27363029, 27513329, 38250763
Adenocarcinoma of Lung	Associate	27513329
Adrenoleukodystrophy	Associate	19097204
Alcoholism	Associate	21876473
Ameloblastoma	Associate	39675431
Amyotrophic Lateral Sclerosis	Inhibit	26212797
Aortic Valve Stenosis	Associate	36809926
Arthritis Rheumatoid	Associate	19274078, 21385358, 22127696, 25975695, 26134265, 29476097, 30828336, 30876808
Atrophy	Associate	34051265
Barrett Esophagus	Stimulate	27363029
Bipolar Disorder	Associate	21876473
Bone Cysts Aneurysmal	Associate	15509545, 32859633
Breast Neoplasms	Associate	11775026, 19274078, 33899544
Calcinosis	Associate	36809926
Calcinosis Cutis	Associate	36610328
Carcinogenesis	Associate	22968929
Carcinoma Hepatocellular	Associate	32311840
Carcinoma Non Small Cell Lung	Associate	27513329, 30290240
Carcinoma Renal Cell	Associate	20121140
Cartilage Diseases	Associate	18821672
Cartilage Diseases	Stimulate	22127696
Central Nervous System Diseases	Associate	28854563
Choriocarcinoma	Associate	14675328
Colorectal Neoplasms	Associate	22968929, 36377223, 40001597
Diabetes Mellitus	Associate	33102604
Drug Resistant Epilepsy	Associate	31160603
Dysplastic Nevus Syndrome	Associate	24999589
Ehlers Danlos syndrome type 3	Associate	29309923
Endometrial Neoplasms	Associate	25811593
Familial cylindromatosis	Associate	16107186
Fibrosis	Stimulate	34051265
Gestational Trophoblastic Disease	Associate	14675328
Heart Diseases	Associate	33811546
Hematuria Benign Familial	Stimulate	26671310
Hydatidiform Mole	Associate	14675328
Hyperkeratosis Epidermolytic	Inhibit	35421402
Hypertelorism	Associate	33811546
Hypertelorism with esophageal abnormality and hypospadias	Associate	33811546
Inflammation	Associate	15743489, 18821672, 24495480, 30876808, 32929367, 9767543
Inflammatory Bowel Diseases	Associate	16107186
Keloid	Associate	27943413
Kidney Diseases	Associate	34051265
Kidney Failure Chronic	Inhibit	9767543
Liver Failure	Associate	27855278, 36610328
Lung Diseases Interstitial	Associate	18821672
Lung Neoplasms	Associate	27513329, 30290240
Lymphoma	Inhibit	28854563
Lymphoma Large B Cell Diffuse	Associate	28854563
Malignant mesenchymal tumor	Associate	10550312
MASS syndrome	Associate	26178921
Melanoma	Associate	24999589
Melanosis	Associate	24940649
Melanosis	Stimulate	26671310
Melanosis	Inhibit	35840442
Myopia	Stimulate	37979904
Neoplasm Metastasis	Associate	10550312, 20484040, 23971040, 29075357, 30987656, 36610328
Neoplasm Metastasis	Inhibit	18359978
Neoplasm Metastasis	Stimulate	27855278
Neoplasms	Associate	19274078, 27363029, 29075357, 30723390, 31160603, 32694700
Neoplasms	Inhibit	20534969, 22139084
Neoplasms Adipose Tissue	Associate	9555938
Nose Diseases	Associate	33811546
Obesity	Associate	8532024, 8751871, 9153282, 9555938, 9842990
Obesity Morbid	Associate	17986612
Osteoarthritis	Associate	20060954
Osteochondroma	Associate	23971040
Osteosarcoma	Associate	10550312, 18359978, 23971040
Osteosclerosis	Associate	26178921
Ovarian Neoplasms	Associate	31689861
Pancreatic Neoplasms	Associate	27855278
Pancreatitis Chronic	Stimulate	27855278
Prader Willi Syndrome	Associate	9842990
Precursor Cell Lymphoblastic Leukemia Lymphoma	Associate	28292214
Prostatic Neoplasms	Associate	18057003, 20484040
Rhabdomyosarcoma	Associate	34285060
Sarcoma Ewing	Associate	38113033
Skin Diseases	Associate	26671310
Squamous Cell Carcinoma of Head and Neck	Associate	18490578
Stomach Neoplasms	Associate	26769141, 30987656, 32463580, 36610328
Synovitis	Associate	18821672
Synovitis Pigmented Villonodular	Associate	32929367
Tertiary Lymphoid Structures	Associate	36610328
Urinary Bladder Neoplasms	Associate	36595851
Uterine Cervical Neoplasms	Associate	15989693
Waterborne Diseases	Associate	33811546

CDH11 (cadherin 11)