Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
100861412
Gene name Gene Name - the full gene name approved by the HGNC.
Fibrinogen silencer binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FSBP
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q22.1
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT712832 hsa-miR-935 HITS-CLIP 19536157
MIRT712831 hsa-miR-4777-3p HITS-CLIP 19536157
MIRT712830 hsa-miR-3144-3p HITS-CLIP 19536157
MIRT712832 hsa-miR-935 HITS-CLIP 19536157
MIRT712831 hsa-miR-4777-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20531236, 25416956, 25814554, 25910212, 32814053
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 20531236
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
616306 43653 ENSG00000265817
Protein
UniProt ID O95073
Protein name Fibrinogen silencer-binding protein
Protein function Transcriptional repressor that down-regulates the expression of the fibrinogen gamma chain. Represses transcription of GSK3B gene promoter via its interaction with APBA1.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13873 Myb_DNA-bind_5 6 85 Myb/SANT-like DNA-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in multiple tissues including brain. {ECO:0000269|PubMed:20531236}.
Sequence
MVGKARSSNFTLSEKLDLLKLVKPYVKILEEHTNKHSVIVEKNRCWDIIAVNYNAIGVDR
PPRTAQGLRTLYKRLKEYAKQELLQ
QKETQSDFKSNISEPTKKVMEMIPQISSFCLVRDR
NHIQSANLDEEAQAGTSSLQVMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQRE
EHELVHVMERSLSPSLSSVDMRMTSSPSSIPRRDDFFRHESGEHFRSLLGYDPQILQMLK
EEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEVEKLKAIRLRHDLPEYNSL
Sequence length 299
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Acute radiotoxicity in breast cancer N/A N/A GWAS