FSBP (fibrinogen silencer binding protein)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein
Entrez ID 100861412
Gene name Fibrinogen silencer binding protein
Gene symbol FSBP
Synonyms (NCBI Gene)
-
Chromosome 8
Chromosome location 8q22.1
miRNA miRNA information provided by mirtarbase database.
6
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (6)
miRTarBase ID miRNA Experiments Reference
MIRT712832 hsa-miR-935 HITS-CLIP 19536157
MIRT712831 hsa-miR-4777-3p HITS-CLIP 19536157
MIRT712830 hsa-miR-3144-3p HITS-CLIP 19536157
MIRT712832 hsa-miR-935 HITS-CLIP 19536157
MIRT712831 hsa-miR-4777-3p HITS-CLIP 19536157
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
Gene miRNA Gene ontology Other IDs Protein
Show/Hide all (6)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20531236, 25416956, 25814554, 25910212, 32814053
GO:0005634 Component Nucleus IBA
GO:0005634 Component Nucleus IDA 20531236
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein
MIM HGNC e!Ensembl
616306 43653 ENSG00000265817
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O95073
Protein name Fibrinogen silencer-binding protein
Protein function Transcriptional repressor that down-regulates the expression of the fibrinogen gamma chain. Represses transcription of GSK3B gene promoter via its interaction with APBA1.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13873 Myb_DNA-bind_5 6 → 85 Myb/SANT-like DNA-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in multiple tissues including brain. {ECO:0000269|PubMed:20531236}.
Sequence 
MVGKARSSNFTLSEKLDLLKLVKPYVKILEEHTNKHSVIVEKNRCWDIIAVNYNAIGVDR
PPRTAQGLRTLYKRLKEYAKQELLQQKETQSDFKSNISEPTKKVMEMIPQISSFCLVRDR
NHIQSANLDEEAQAGTSSLQVMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQRE
EHELVHVMERSLSPSLSSVDMRMTSSPSSIPRRDDFFRHESGEHFRSLLGYDPQILQMLK
EEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEVEKLKAIRLRHDLPEYNSL
Sequence length 299
Interactions View interactions