FSBP (fibrinogen silencer binding protein)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
100861412
Gene name Gene Name - the full gene name approved by the HGNC.
Fibrinogen silencer binding protein
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
FSBP
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q22.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(6)
miRTarBase ID miRNA Experiments Reference
MIRT712832 hsa-miR-935 HITS-CLIP 19536157
MIRT712831 hsa-miR-4777-3p HITS-CLIP 19536157
MIRT712830 hsa-miR-3144-3p HITS-CLIP 19536157
MIRT712832 hsa-miR-935 HITS-CLIP 19536157
MIRT712831 hsa-miR-4777-3p HITS-CLIP 19536157
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(5)
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 20531236, 25416956
GO:0005634 Component Nucleus IBA 21873635
GO:0005634 Component Nucleus IDA 20531236
GO:0005654 Component Nucleoplasm IDA
GO:0042802 Function Identical protein binding IPI 19060904, 25416956
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
616306 43653 ENSG00000265817
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID O95073
Protein name Fibrinogen silencer-binding protein
Protein function Transcriptional repressor that down-regulates the expression of the fibrinogen gamma chain. Represses transcription of GSK3B gene promoter via its interaction with APBA1.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13873 Myb_DNA-bind_5 6 → 85 Myb/SANT-like DNA-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in multiple tissues including brain. {ECO:0000269|PubMed:20531236}.
Sequence 
MVGKARSSNFTLSEKLDLLKLVKPYVKILEEHTNKHSVIVEKNRCWDIIAVNYNAIGVDR
PPRTAQGLRTLYKRLKEYAKQELLQQKETQSDFKSNISEPTKKVMEMIPQISSFCLVRDR
NHIQSANLDEEAQAGTSSLQVMLDHHPVAITVEVKQEEDIKPPPPLVLNSQQSDTLEQRE
EHELVHVMERSLSPSLSSVDMRMTSSPSSIPRRDDFFRHESGEHFRSLLGYDPQILQMLK
EEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEVEKLKAIRLRHDLPEYNSL
Sequence length 299
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Colorectal cancer Colorectal Carcinoma rs137854568, rs137854573, rs137854575, rs387906234, rs121908380, rs121908702, rs267606674, rs794729661, rs121909055, rs281865417, rs267606884, rs28934575, rs587776769, rs104893815, rs587776800
View all (467 more)
Show/Hide Unknown Diseases (1)
Unknown
Disease term Disease name Evidence References Source
Breast Cancer Breast Cancer Importantly, breast cancer patients bearing PRC2 LOF mutations displayed significantly worse prognosis compared with PRC2 wild-type patients GWAS, CBGDA