Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10083
Gene name Gene Name - the full gene name approved by the HGNC.
USH1 protein network component harmonin
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
USH1C
Synonyms (NCBI Gene) Gene synonyms aliases
AIE-75, DFNB18, DFNB18A, NY-CO-37, NY-CO-38, PDZ-45, PDZ-73, PDZ-73/NY-CO-38, PDZ73, PDZD7C, ush1cpst
Chromosome Chromosome number
11
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
11p15.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a scaffold protein that functions in the assembly of Usher protein complexes. The protein contains PDZ domains, a coiled-coil region with a bipartite nuclear localization signal and a PEST degradation sequence. Defects in this gene are t
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs41282932 G>A,C,T Likely-benign, uncertain-significance, pathogenic Coding sequence variant, intron variant, missense variant, genic downstream transcript variant
rs55983148 CCCCGCCCTCCCTCCCTCCCACCGTCATGGAGTACTGCCCTGCTC>-,CCCCGCCCTCCCTCCCTCCCACCGTCATGGAGTACTGCCCTGCTCCCCCGCCCTCCCTCCCTCCCACCGTCATGGAGTACTGCCCTGCTCCCCCGCCCTCCCTCCCTCCCACCGTCATGGAGTACTGCCCTGCTCCCCCGCCCTCCCTCCCTCCCACCGTCATGGAGTACTGCCCTGCTCCCCCGCCCTCCCTCCCTCCCACCGTCA Benign, conflicting-interpretations-of-pathogenicity Intron variant
rs121908370 G>A,C Pathogenic Coding sequence variant, stop gained, non coding transcript variant, missense variant
rs138138689 C>A,G,T Pathogenic Splice donor variant
rs140869579 G>A,T Conflicting-interpretations-of-pathogenicity Coding sequence variant, synonymous variant, non coding transcript variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT016712 hsa-miR-335-5p Microarray 18185580
MIRT1477175 hsa-miR-1825 CLIP-seq
MIRT1477176 hsa-miR-185 CLIP-seq
MIRT1477177 hsa-miR-199a-5p CLIP-seq
MIRT1477178 hsa-miR-199b-5p CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000086 Process G2/M transition of mitotic cell cycle IMP 15219944
GO:0001750 Component Photoreceptor outer segment IEA
GO:0001750 Component Photoreceptor outer segment ISS
GO:0001917 Component Photoreceptor inner segment IBA
GO:0001917 Component Photoreceptor inner segment IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
605242 12597 ENSG00000006611
Protein
UniProt ID Q9Y6N9
Protein name Harmonin (Antigen NY-CO-38/NY-CO-37) (Autoimmune enteropathy-related antigen AIE-75) (Protein PDZ-73) (Renal carcinoma antigen NY-REN-3) (Usher syndrome type-1C protein)
Protein function Anchoring/scaffolding protein that is a part of the functional network formed by USH1C, USH1G, CDH23 and MYO7A that mediates mechanotransduction in cochlear hair cells. Required for normal development and maintenance of cochlear hair cell bundle
PDB 1X5N , 2KBQ , 2KBR , 2KBS , 2LSR , 3K1R , 5F3X , 5MV8 , 5MV9 , 5XBF , 7X2E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00595 PDZ 87 165 PDZ domain Domain
PF00595 PDZ 211 290 PDZ domain Domain
PF00595 PDZ 452 537 PDZ domain Domain
Tissue specificity TISSUE SPECIFICITY: Expressed in small intestine, colon, kidney, eye and weakly in pancreas. Expressed also in vestibule of the inner ear. {ECO:0000269|PubMed:12588794}.
Sequence
MDRKVAREFRHKVDFLIENDAEKDYLYDVLRMYHQTMDVAVLVGDLKLVINEPSRLPLFD
AIRPLIPLKHQVEYDQLTPRRSRKLKEVRLDRLHPEGLGLSVRGGLEFGCGLFISHLIKG
GQADSVGLQVGDEIVRINGYSISSCTHEEVINLIRTKKTVSIKVR
HIGLIPVKSSPDEPL
TWQYVDQFVSESGGVRGSLGSPGNRENKEKKVFISLVGSRGLGCSISSGPIQKPGIFISH
VKPGSLSAEVGLEIGDQIVEVNGVDFSNLDHKEAVNVLKSSRSLTISIVA
AAGRELFMTD
RERLAEARQRELQRQELLMQKRLAMESNKILQEQQEMERQRRKEIAQKAAEENERYRKEM
EQIVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDG
GTEEQGEQDFRKYEEGFDPYSMFTPEQIMGKDVRLLRIKKEGSLDLALEGGVDSPIGKVV
VSAVYERGAAERHGGIVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVV
AVC
PPKEYDDELTFF
Sequence length 552
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Deafness Autosomal recessive nonsyndromic hearing loss 18A rs1283092935, rs758555088, rs151045328, rs1317951509, rs147956944, rs921755529, rs397515359, rs775496999, rs1355262412, rs1591961566, rs121908370, rs1565017125, rs762551629, rs1207247951, rs1591999307
View all (10 more)
N/A
hearing impairment Hearing impairment rs1850678559 N/A
Hearing Loss Hearing loss, autosomal recessive rs377145777, rs397515359 N/A
retinal dystrophy Retinal dystrophy rs1850697098, rs1850741468, rs397515359, rs1480243085 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Meniere Disease meniere disease N/A N/A ClinVar
Optic Atrophy optic atrophy N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Carcinoma Renal Cell Associate 29215599
Colorectal Neoplasms Associate 37535601
Congenital Hereditary and Neonatal Diseases and Abnormalities Associate 28653419
Congenital Hyperinsulinism Associate 23150283
Deafness Associate 17407589, 23251578, 28653419, 28660889, 29434063, 33095980, 33724713
Hearing Loss Associate 23122587, 23150283, 23251578, 32991204, 33095980, 33231815, 34194829
Hearing Loss Sensorineural Associate 20146813, 23251578
Hypothyroidism Congenital Nongoitrous 1 Associate 23150283
Hypoxia Associate 29215599
Immune Dysregulation Polyendocrinopathy Enteropathy X Linked Syndrome Associate 24250806