C16orf95 (chromosome 16 open reading frame 95)

Gene
Gene miRNA Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
100506581
Gene name Gene Name - the full gene name approved by the HGNC.
Chromosome 16 open reading frame 95
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
C16orf95
Synonyms (NCBI Gene) Gene synonyms aliases
-
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q24.2
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Other IDs Protein Associated diseases
Show/Hide all(11)
miRTarBase ID miRNA Experiments Reference
MIRT835591 hsa-miR-2116 CLIP-seq
MIRT835592 hsa-miR-4474-3p CLIP-seq
MIRT835593 hsa-miR-4645-3p CLIP-seq
MIRT835594 hsa-miR-4677-5p CLIP-seq
MIRT835595 hsa-miR-4687-3p CLIP-seq
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene miRNA Other IDs Protein Associated diseases
UniProt ID Q9H693
Protein name Uncharacterized protein C16orf95
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15132 DUF4568 50 → 143 Domain of unknown function (DUF4568) Family
Sequence 
MRASRSPPSPRRCHHHHEATGAASGAAAGGPGAGCVGLCRLALTPSAQDGRNSTFQTYKK
EVCLPRHSMHPGPWAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGT
TAGGSAVMSACCPSSSSSRPPTRTSYRLLQRVCCPSAS
Sequence length 158
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Breast Cancer Postmenopausal breast cancer N/A N/A GWAS
Show/Hide Text Mining Associations (1)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Lymphedema distichiasis syndrome Stimulate 22407726