C16orf95 (chromosome 16 open reading frame 95)

Gene

• Entrez ID: 100506581
• Gene name: Chromosome 16 open reading frame 95
• Gene symbol: C16orf95
• Synonyms (NCBI Gene): -
• Chromosome: 16
• Chromosome location: 16q24.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT835591	hsa-miR-2116	CLIP-seq
MIRT835592	hsa-miR-4474-3p	CLIP-seq
MIRT835593	hsa-miR-4645-3p	CLIP-seq
MIRT835594	hsa-miR-4677-5p	CLIP-seq
MIRT835595	hsa-miR-4687-3p	CLIP-seq
MIRT835596	hsa-miR-4699-5p	CLIP-seq
MIRT835597	hsa-miR-526b	CLIP-seq
MIRT2185585	hsa-miR-3622a-3p	CLIP-seq
MIRT2185586	hsa-miR-3622b-3p	CLIP-seq
MIRT2185587	hsa-miR-4502	CLIP-seq
MIRT2185588	hsa-miR-539	CLIP-seq

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: Q9H693
• Protein name: Uncharacterized protein C16orf95
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15132	DUF4568	50 → 143	Domain of unknown function (DUF4568)	Family

• Sequence:

  MRASRSPPSPRRCHHHHEATGAASGAAAGGPGAGCVGLCRLALTPSAQDGRNSTFQTYKK
  EVCLPRHSMHPGPWAICCECQTRFGGRLPVSRVEAALPYWVPLSLRPRKQHPCWMHAAGT
  TAGGSAVMSACCPSSSSSRPPTRTSYRLLQRVCCPSAS

• Sequence length: 158

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIAC EMBOLISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOEMBOLIC STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL LEFT-SIDED HEART LESIONS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Lymphedema distichiasis syndrome	Stimulate	22407726	★☆☆☆☆ Found in Text Mining only