TMEM238L (transmembrane protein 238 like)

Gene

• Entrez ID: 100289255
• Gene name: Transmembrane protein 238 like
• Gene symbol: TMEM238L
• Synonyms (NCBI Gene): FORCP, LINC00675
• Chromosome: 17
• Chromosome location: 17p13.1-p12

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	33112233
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IDA	33112233
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IMP	33112233

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: A6NJY4
• Protein name: Transmembrane protein 238-like (FOXA1-regulated conserved small protein) (FORCP)
• Protein function: May play a role in inducing apoptosis during endoplasmic reticulum (ER) stress and in the inhibition of proliferation and tumorigenicity.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF15125	TMEM238	13 → 76	TMEM238 protein family	Family

• Sequence:

  MLLGSLWGRCHPGCCALFLILALLLDAVGLVLLLLGILAPLSSWDFFIYTGALILALSLL
  LWIIWYSLNIEVSPEKLDL

• Sequence length: 79

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
COLORECTAL ADENOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Relationship Type	References	Evidence Score
Breast Neoplasms	Inhibit	34738869	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Inhibit	30556869	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Associate	26309360	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Inhibit	32196582	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Associate	30061182, 31442207	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Inhibit	30556869	★☆☆☆☆ Found in Text Mining only
Glioma	Associate	30061182	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Stimulate	26309360	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Inhibit	30556869	★☆☆☆☆ Found in Text Mining only
Neoplasm Invasiveness	Inhibit	34738869	★☆☆☆☆ Found in Text Mining only
Neoplasms	Stimulate	30061182	★☆☆☆☆ Found in Text Mining only
Neoplasms	Inhibit	30556869	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Associate	26309360, 30061182	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Associate	30061182	★☆☆☆☆ Found in Text Mining only
Tarlov Cysts	Stimulate	26309360	★☆☆☆☆ Found in Text Mining only