Gene Gene information from NCBI Gene database.
Entrez ID 100287932
Gene name Translocase of inner mitochondrial membrane 23
Gene symbol TIMM23
Synonyms (NCBI Gene)
TIM23
Chromosome 10
Chromosome location 10q11.22
Summary The protein encoded by this gene is part of a complex located in the inner mitochondrial membrane that mediates the transport of transit peptide-containing proteins across the membrane. Multiple transcript variants, one protein-coding and others not prote
miRNA miRNA information provided by mirtarbase database.
141
miRTarBase ID miRNA Experiments Reference
MIRT026070 hsa-miR-196a-5p Sequencing 20371350
MIRT032261 hsa-let-7b-5p Proteomics 18668040
MIRT046055 hsa-miR-125b-5p CLASH 23622248
MIRT042029 hsa-miR-484 CLASH 23622248
MIRT1425012 hsa-miR-1290 CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
23
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 15044455, 23260140, 23263864, 32296183, 32814053, 37160114
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IDA
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IDA 10339406, 20053669, 25997101
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605034 17312 ENSG00000265354
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
O14925
Protein name Mitochondrial import inner membrane translocase subunit Tim23
Protein function Essential component of the TIM23 complex, a complex that mediates the translocation of transit peptide-containing proteins across the mitochondrial inner membrane (PubMed:10339406). Has a role in the activation of stress-induced mitophagy by pro
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02466 Tim17 76 188 Family
Sequence
MEGGGGSGNKTTGGLAGFFGAGGAGYSHADLAGVPLTGMNPLSPYLNVDPRYLVQDTDEF
ILPTGANKTRGRFELAFFTIGGCCMTGAAFGAMNGLRLGLKETQNMAWSKPRNVQILNMV
TRQGALWANTLGSLALLYSAFGVIIEKTRGAEDDLNTVAAGTMTGMLYKCTGGLRGIARG
GLTGLTLT
SLYALYNNWEHMKGSLLQQSL
Sequence length 209
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    Mitochondrial protein import