KLLN (killin, p53 regulated DNA replication inhibitor)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 100144748
Gene name Killin, p53 regulated DNA replication inhibitor
Gene symbol KLLN
Synonyms (NCBI Gene)
CWS4KILLIN
Chromosome 10
Chromosome location 10q23.31
Summary The protein encoded by this intronless gene is found in the nucleus, where it can inhibit DNA synthesis and promote S phase arrest coupled to apoptosis. The expression of this DNA binding protein is upregulated by transcription factor p53. [provided by Re
miRNA miRNA information provided by mirtarbase database.
561
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (561)
miRTarBase ID miRNA Experiments Reference
MIRT633456 hsa-miR-383-3p HITS-CLIP 23824327
MIRT633455 hsa-miR-132-5p HITS-CLIP 23824327
MIRT633454 hsa-miR-6089 HITS-CLIP 23824327
MIRT633453 hsa-miR-1908-5p HITS-CLIP 23824327
MIRT633452 hsa-miR-663a HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
5
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (5)
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005730 Component Nucleolus IDA
GO:0006915 Process Apoptotic process IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
612105 37212 ENSG00000227268
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
B2CW77
Protein name Killin
Protein function DNA-binding protein involved in S phase checkpoint control-coupled apoptosis by mediating p53/TP53-induced apoptosis. Has the ability to inhibit DNA synthesis and S phase arrest coupled to apoptosis. Has affinity to both double- and single-stran
Family and domains
Sequence 
MDRPGPGSARPGRTVHVWGYRVEWKVRNGRKLQPSEWAGRGDLGGFKRRWKDTRATVGTT
FRRRSRVSLVGELSKFPLPSDSSGGKSSSSFARGALAWCRQRNPNPSCAAAETGARTSLP
KERCRGWRLGNWLHKHPHPNTCPRLPACWLPPILTERGERVPKLVPLLACYPKSKPKD
Sequence length 178
Interactions View interactions
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
6
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (3)
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cowden syndrome 4 Uncertain significance rs1858277807, rs2132136560, rs548448478 RCV002243575
RCV002243576
RCV003133898
KLLN-related disorder Likely benign rs781685752, rs374921871 RCV003943957
RCV003949728
PTEN hamartoma tumor syndrome Uncertain significance rs1244675683 RCV000988406
Show/Hide Text Mining Associations (15)
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 23446638, 36123344
Carcinoma Pancreatic Ductal Associate 38015024
Carcinoma Renal Cell Associate 21584899
Colorectal Neoplasms Associate 34878965
Cowden Like Syndrome Associate 21177507, 21584899, 21956414, 23446638, 25376524
Drug Related Side Effects and Adverse Reactions Associate 27295081
Endometrial Neoplasms Associate 25376524
Hamartoma Syndrome Multiple Associate 21177507, 21584899, 21956414, 25376524, 25669429
Neoplasms Inhibit 21177507, 23386643
Neoplasms Associate 21584899, 25669429, 26673699