Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
100144748
Gene name Gene Name - the full gene name approved by the HGNC.
Killin, p53 regulated DNA replication inhibitor
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
KLLN
Synonyms (NCBI Gene) Gene synonyms aliases
CWS4, KILLIN
Chromosome Chromosome number
10
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
10q23.31
Summary Summary of gene provided in NCBI Entrez Gene.
The protein encoded by this intronless gene is found in the nucleus, where it can inhibit DNA synthesis and promote S phase arrest coupled to apoptosis. The expression of this DNA binding protein is upregulated by transcription factor p53. [provided by Re
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT633456 hsa-miR-383-3p HITS-CLIP 23824327
MIRT633455 hsa-miR-132-5p HITS-CLIP 23824327
MIRT633454 hsa-miR-6089 HITS-CLIP 23824327
MIRT633453 hsa-miR-1908-5p HITS-CLIP 23824327
MIRT633452 hsa-miR-663a HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0003677 Function DNA binding IEA
GO:0005634 Component Nucleus IEA
GO:0005654 Component Nucleoplasm IDA
GO:0005730 Component Nucleolus IDA
GO:0006915 Process Apoptotic process IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
612105 37212 ENSG00000227268
Protein
UniProt ID B2CW77
Protein name Killin
Protein function DNA-binding protein involved in S phase checkpoint control-coupled apoptosis by mediating p53/TP53-induced apoptosis. Has the ability to inhibit DNA synthesis and S phase arrest coupled to apoptosis. Has affinity to both double- and single-stran
Family and domains
Sequence
MDRPGPGSARPGRTVHVWGYRVEWKVRNGRKLQPSEWAGRGDLGGFKRRWKDTRATVGTT
FRRRSRVSLVGELSKFPLPSDSSGGKSSSSFARGALAWCRQRNPNPSCAAAETGARTSLP
KERCRGWRLGNWLHKHPHPNTCPRLPACWLPPILTERGERVPKLVPLLACYPKSKPKD
Sequence length 178
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Metabolic Syndrome Metabolic syndrome N/A N/A GWAS
PTEN Hamartoma Tumor Syndrome pten hamartoma tumor syndrome N/A N/A ClinVar
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 23446638, 36123344
Carcinoma Pancreatic Ductal Associate 38015024
Carcinoma Renal Cell Associate 21584899
Colorectal Neoplasms Associate 34878965
Cowden Like Syndrome Associate 21177507, 21584899, 21956414, 23446638, 25376524
Drug Related Side Effects and Adverse Reactions Associate 27295081
Endometrial Neoplasms Associate 25376524
Hamartoma Syndrome Multiple Associate 21177507, 21584899, 21956414, 25376524, 25669429
Neoplasms Inhibit 21177507, 23386643
Neoplasms Associate 21584899, 25669429, 26673699