Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	10014
Gene name Gene Name - the full gene name approved by the HGNC.	Histone deacetylase 5
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	HDAC5
Synonyms (NCBI Gene) Gene synonyms aliases	HD5, NY-CO-9
Chromosome Chromosome number	17
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	17q21.31
Summary Summary of gene provided in NCBI Entrez Gene.	Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene b

Show/Hide all(113)

miRTarBase ID	miRNA	Experiments	Reference
MIRT029704	hsa-miR-26b-5p	Microarray	19088304
MIRT052514	hsa-let-7a-5p	CLASH	23622248
MIRT491540	hsa-miR-4476	PAR-CLIP	23592263
MIRT491541	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT491539	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT491538	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT491537	hsa-miR-8089	PAR-CLIP	23592263
MIRT491536	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT491535	hsa-miR-4533	PAR-CLIP	23592263
MIRT491534	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT491533	hsa-miR-765	PAR-CLIP	23592263
MIRT491531	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT491532	hsa-miR-3175	PAR-CLIP	23592263
MIRT491530	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT491529	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT491528	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT491527	hsa-miR-4536-5p	PAR-CLIP	23592263
MIRT491526	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT491525	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT733621	hsa-miR-185-5p	Microarray	34012635
MIRT733621	hsa-miR-185-5p	Microarray	34012635
MIRT733850	hsa-miR-134-5p	Luciferase reporter assay, Microarray, Western blotting	32783377
MIRT735592	hsa-miR-423-3p	Western blotting, Immunohistochemistry (IHC), qRT-PCR	32089706
MIRT491540	hsa-miR-4476	PAR-CLIP	23592263
MIRT491541	hsa-miR-6876-5p	PAR-CLIP	23592263
MIRT491539	hsa-miR-4667-5p	PAR-CLIP	23592263
MIRT491538	hsa-miR-4700-5p	PAR-CLIP	23592263
MIRT491537	hsa-miR-8089	PAR-CLIP	23592263
MIRT491536	hsa-miR-1252-5p	PAR-CLIP	23592263
MIRT491535	hsa-miR-4533	PAR-CLIP	23592263
MIRT491534	hsa-miR-766-5p	PAR-CLIP	23592263
MIRT491533	hsa-miR-765	PAR-CLIP	23592263
MIRT491531	hsa-miR-7106-5p	PAR-CLIP	23592263
MIRT491532	hsa-miR-3175	PAR-CLIP	23592263
MIRT491530	hsa-miR-1343-5p	PAR-CLIP	23592263
MIRT491529	hsa-miR-939-5p	PAR-CLIP	23592263
MIRT491528	hsa-miR-6825-5p	PAR-CLIP	23592263
MIRT491527	hsa-miR-4536-5p	PAR-CLIP	23592263
MIRT491526	hsa-miR-3150a-3p	PAR-CLIP	23592263
MIRT491525	hsa-miR-6763-5p	PAR-CLIP	23592263
MIRT756180	hsa-miR-4256	Luciferase reporter assay, Western blotting, qRT-PCR, ChIP-seq	37415735
MIRT1042481	hsa-miR-1224-3p	CLIP-seq
MIRT1042482	hsa-miR-1302	CLIP-seq
MIRT1042483	hsa-miR-24	CLIP-seq
MIRT1042484	hsa-miR-3065-3p	CLIP-seq
MIRT1042485	hsa-miR-3126-5p	CLIP-seq
MIRT1042486	hsa-miR-4283	CLIP-seq
MIRT1042487	hsa-miR-4298	CLIP-seq
MIRT1042488	hsa-miR-4434	CLIP-seq
MIRT1042489	hsa-miR-4437	CLIP-seq
MIRT1042490	hsa-miR-4489	CLIP-seq
MIRT1042491	hsa-miR-4516	CLIP-seq
MIRT1042492	hsa-miR-4531	CLIP-seq
MIRT1042493	hsa-miR-4643	CLIP-seq
MIRT1042494	hsa-miR-4717-3p	CLIP-seq
MIRT1042495	hsa-miR-4723-5p	CLIP-seq
MIRT1042496	hsa-miR-4728-5p	CLIP-seq
MIRT1042497	hsa-miR-642b	CLIP-seq
MIRT1042498	hsa-miR-661	CLIP-seq
MIRT1042488	hsa-miR-4434	CLIP-seq
MIRT1042491	hsa-miR-4516	CLIP-seq
MIRT1042492	hsa-miR-4531	CLIP-seq
MIRT1042499	hsa-miR-520d-5p	CLIP-seq
MIRT1042500	hsa-miR-524-5p	CLIP-seq
MIRT2008999	hsa-miR-4640-3p	CLIP-seq
MIRT2009000	hsa-miR-4667-3p	CLIP-seq
MIRT2241348	hsa-miR-1270	CLIP-seq
MIRT2241349	hsa-miR-1291	CLIP-seq
MIRT2241350	hsa-miR-3151	CLIP-seq
MIRT2241351	hsa-miR-3160-3p	CLIP-seq
MIRT2241352	hsa-miR-3190	CLIP-seq
MIRT2241353	hsa-miR-4254	CLIP-seq
MIRT2241354	hsa-miR-4308	CLIP-seq
MIRT2008999	hsa-miR-4640-3p	CLIP-seq
MIRT2241355	hsa-miR-4683	CLIP-seq
MIRT2241356	hsa-miR-4777-5p	CLIP-seq
MIRT2241357	hsa-miR-4786-3p	CLIP-seq
MIRT2241358	hsa-miR-509-3p	CLIP-seq
MIRT2241359	hsa-miR-518d-5p	CLIP-seq
MIRT2241360	hsa-miR-519b-5p	CLIP-seq
MIRT2241361	hsa-miR-519c-5p	CLIP-seq
MIRT2241362	hsa-miR-520c-5p	CLIP-seq
MIRT2241363	hsa-miR-526a	CLIP-seq
MIRT2241364	hsa-miR-541	CLIP-seq
MIRT2241365	hsa-miR-620	CLIP-seq
MIRT2241366	hsa-miR-654-5p	CLIP-seq
MIRT2241367	hsa-miR-671-5p	CLIP-seq
MIRT2241368	hsa-miR-939	CLIP-seq
MIRT2451044	hsa-miR-103a	CLIP-seq
MIRT2451045	hsa-miR-107	CLIP-seq
MIRT2451046	hsa-miR-1913	CLIP-seq
MIRT2451047	hsa-miR-3127-3p	CLIP-seq
MIRT2451048	hsa-miR-324-3p	CLIP-seq
MIRT2451049	hsa-miR-4713-5p	CLIP-seq
MIRT2451050	hsa-miR-4749-3p	CLIP-seq
MIRT2545031	hsa-miR-4419a	CLIP-seq
MIRT2545032	hsa-miR-4510	CLIP-seq
MIRT2545033	hsa-miR-4690-5p	CLIP-seq
MIRT2241356	hsa-miR-4777-5p	CLIP-seq
MIRT2241359	hsa-miR-518d-5p	CLIP-seq
MIRT2241360	hsa-miR-519b-5p	CLIP-seq
MIRT2241361	hsa-miR-519c-5p	CLIP-seq
MIRT2241362	hsa-miR-520c-5p	CLIP-seq
MIRT2241363	hsa-miR-526a	CLIP-seq
MIRT2545031	hsa-miR-4419a	CLIP-seq
MIRT2545032	hsa-miR-4510	CLIP-seq
MIRT2545033	hsa-miR-4690-5p	CLIP-seq
MIRT2241356	hsa-miR-4777-5p	CLIP-seq
MIRT2241359	hsa-miR-518d-5p	CLIP-seq
MIRT2241360	hsa-miR-519b-5p	CLIP-seq
MIRT2241361	hsa-miR-519c-5p	CLIP-seq
MIRT2241362	hsa-miR-520c-5p	CLIP-seq
MIRT2241363	hsa-miR-526a	CLIP-seq

Show/Hide all(47)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	TAS	12711221
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	16236793
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IMP	10983972, 19351956, 23867755
GO:0000976	Function	Transcription regulatory region sequence-specific DNA binding	IDA	19351956
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	24413532
GO:0001085	Function	RNA polymerase II transcription factor binding	IPI	23867755
GO:0003682	Function	Chromatin binding	IEA
GO:0004407	Function	Histone deacetylase activity	IDA	10869435
GO:0005080	Function	Protein kinase C binding	IPI	20188095
GO:0005515	Function	Protein binding	IPI	10869435, 10898795, 15161933, 15194749, 15923258, 16919237, 17075044, 17872950, 18711143, 19666599, 22649097, 23752268, 24229708, 24413532, 28514442, 32296183
GO:0005634	Component	Nucleus	IDA	10869435, 11081517, 23867755, 26157139
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IDA	10869435, 11081517, 26157139
GO:0005794	Component	Golgi apparatus	IDA
GO:0005829	Component	Cytosol	IDA
GO:0006325	Process	Chromatin organization	TAS	12711221
GO:0006338	Process	Chromatin remodeling	TAS	10220385
GO:0006342	Process	Chromatin silencing	TAS	10869435
GO:0006476	Process	Protein deacetylation	IMP	23867755
GO:0006954	Process	Inflammatory response	TAS	12711221
GO:0008134	Function	Transcription factor binding	IPI	19071119, 20408817
GO:0010830	Process	Regulation of myotube differentiation	ISS
GO:0010832	Process	Negative regulation of myotube differentiation	IMP	10983972, 11081517
GO:0014823	Process	Response to activity	IEA
GO:0016575	Process	Histone deacetylation	IDA	10869435
GO:0016607	Component	Nuclear speck	IDA
GO:0030182	Process	Neuron differentiation	IEA
GO:0030183	Process	B cell differentiation	TAS	12711221
GO:0032041	Function	NAD-dependent histone deacetylase activity (H3-K14 specific)	IEA
GO:0032869	Process	Cellular response to insulin stimulus	NAS	18184930
GO:0033558	Function	Protein deacetylase activity	IMP	23867755
GO:0040029	Process	Regulation of gene expression, epigenetic	IMP	24413532
GO:0042113	Process	B cell activation	TAS	12711221
GO:0042220	Process	Response to cocaine	IEA
GO:0042493	Process	Response to drug	IEA
GO:0042802	Function	Identical protein binding	IPI	32296183
GO:0042826	Function	Histone deacetylase binding	IPI	23867755
GO:0043393	Process	Regulation of protein binding	IMP	19071119
GO:0045892	Process	Negative regulation of transcription, DNA-templated	TAS	12711221
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IMP	19071119
GO:0046872	Function	Metal ion binding	IEA
GO:0051091	Process	Positive regulation of DNA-binding transcription factor activity	IMP	19071119
GO:0070491	Function	Repressing transcription factor binding	IPI	12242305
GO:0070932	Process	Histone H3 deacetylation	IEA
GO:0071222	Process	Cellular response to lipopolysaccharide	IEA
GO:0090051	Process	Negative regulation of cell migration involved in sprouting angiogenesis	IMP	19351956
GO:2000615	Process	Regulation of histone H3-K9 acetylation	IMP	23867755

MIM	HGNC	e!Ensembl
605315	14068	ENSG00000108840

Protein

UniProt ID

Q9UQL6

Protein name

Histone deacetylase 5 (HD5) (EC 3.5.1.98) (Antigen NY-CO-9)

Protein function

Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell c

PDB

5UWI , 8Q9P

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF12203	HDAC4_Gln	67 → 164	Glutamine rich N terminal domain of histone deacetylase 4	Family
PF00850	Hist_deacetyl	704 → 1022	Histone deacetylase domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous.

Sequence

MNSPNESDGMSGREPSLEILPRTSLHSIPVTVEVKPVLPRAMPSSMGGGGGGSPSPVELR
GALVGSVDPTLREQQLQQELLALKQQQQLQKQLLFAEFQKQHDHLTRQHEVQLQKHLKQQ
QEMLAAKQQQEMLAAKRQQELEQQRQREQQRQEELEKQRLEQQLLILRNKEKSKESAIAS
TEVKLRLQEFLLSKSKEPTPGGLNHSLPQHPKCWGAHHASLDQSSPPQSGPPGTPPSYKL
PLPGPYDSRDDFPLRKTASEPNLKVRSRLKQKVAERRSSPLLRRKDGTVISTFKKRAVEI
TGAGPGASSVCNSAPGSGPSSPNSSHSTIAENGFTGSVPNIPTEMLPQHRALPLDSSPNQ
FSLYTSPSLPNISLGLQATVTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMST
SSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPLHGQSPLVTGERVATS
MRTVGKLPRHRPLSRTQSSPLPQSPQALQQLVMQQQHQQFLEKQKQQQLQLGKILTKTGE
LPRQPTTHPEETEEELTEQQEVLLGEGALTMPREGSTESESTQEDLEEEDEEDDGEEEED
CIQVKDEEGESGAEEGPDLEEPGAGYKKLFSDAQPLQPLQVYQAPLSLATVPHQALGRTQ
SSPAAPGGMKSPPDQPVKHLFTTGVVYDTFMLKHQCMCGNTHVHPEHAGRIQSIWSRLQE
TGLLSKCERIRGRKATLDEIQTVHSEYHTLLYGTSPLNRQKLDSKKLLGPISQKMYAVLP
CGGIGVDSDTVWNEMHSSSAVRMAVGCLLELAFKVAAGELKNGFAIIRPPGHHAEESTAM
GFCFFNSVAITAKLLQQKLNVGKVLIVDWDIHHGNGTQQAFYNDPSVLYISLHRYDNGNF
FPGSGAPEEVGGGPGVGYNVNVAWTGGVDPPIGDVEYLTAFRTVVMPIAHEFSPDVVLVS
AGFDAVEGHLSPLGGYSVTARCFGHLTRQLMTLAGGRVVLALEGGHDLTAICDASEACVS
ALLSVELQPLDEAVLQQKPNINAVATLEKVIEIQSKHWSCVQKFAAGLGRSLREAQAGET
EEAETVSAMALLSVGAEQAQAAAAREHSPRPAEEPMEQEPAL

Sequence length

1122

Interactions

View interactions

	KEGG		Reactome
	Apelin signaling pathway Neutrophil extracellular trap formation Alcoholism Viral carcinogenesis MicroRNAs in cancer		Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants Notch-HLH transcription pathway

Show/Hide Causal Diseases (3)

Disease term	Disease name	dbSNP ID	References
Causal
Osteoporosis	Osteoporosis	rs72658152, rs72667023, rs587776916, rs72656370, rs768615287	26723575
Pulmonary arterial hypertension	Idiopathic pulmonary arterial hypertension	rs121909288, rs137852741, rs137852742, rs137852743, rs137852744, rs137852745, rs137852746, rs137852748, rs137852749, rs137852750, rs137852751, rs137852753, rs863223423, rs863223426, rs863223424 View all (116 more)	22711276
Pulmonary hypertension	Familial primary pulmonary hypertension, Pulmonary Hypertension, Primary, 1	rs5030847, rs5030850, rs753751183, rs121912592, rs121912593, rs121912596, rs121918359, rs137852741, rs137852742, rs137852743, rs137852744, rs137852745, rs137852746, rs137852747, rs137852748 View all (349 more)	22711276

Show/Hide Unknown Diseases (2)

Disease term	Disease name	References	Source
Unknown
Mental depression	Mental Depression, Depressive disorder, Unipolar Depression, Major Depressive Disorder	24495952, 16501568, 17258370	ClinVar
Bipolar Disorder	Bipolar Disorder		GWAS

Show/Hide Text Mining Associations (55)

Disease Name	Relationship Type	References
Associations from Text Mining
Anemia	Associate	34036344
Anemia Diamond Blackfan	Associate	34036344
Aortic Aneurysm Abdominal	Associate	31001930
Arthritis Rheumatoid	Associate	23632129, 25452308
Atherosclerosis	Associate	20042720
Atrial Fibrillation	Inhibit	35756425
Breast Neoplasms	Associate	27177225, 31690832
Breast Neoplasms	Stimulate	27212032
Carcinogenesis	Associate	24092570, 27246208
Carcinoma Hepatocellular	Associate	24706304, 28653891
Carcinoma Pancreatic Ductal	Associate	32341020, 36102738
Carcinoma Squamous Cell	Associate	24191246
Chordoma	Associate	23893747
Colorectal Neoplasms	Associate	32711442, 33673279
Crohn Disease	Associate	36175163
Depressive Disorder	Associate	38242038
Diabetes Mellitus	Associate	36360783
Epilepsy Familial Mesial Temporal Lobe	Stimulate	33258018
Failed Back Surgery Syndrome	Associate	20443916
Fibrosarcoma	Associate	23729589
Fibrosis	Associate	35624179
Glioma	Associate	25791281, 26261519, 35545840, 37528157
Heart Diseases	Associate	22865920, 27177225, 27246208
Hematologic Diseases	Stimulate	36293392
Hepatitis C Chronic	Associate	37632052
Hypertrophy	Associate	35756425
Hypoxia	Associate	26061431, 28653891
Hypoxia Brain	Associate	26061431
Inflammation	Associate	20042720, 24445954, 25452308, 36102738, 36430854
Keratoconus	Associate	37108600
Midline granulomatosis	Associate	31989434
Multiple Myeloma	Associate	25482492
Muscular Dystrophies	Associate	36352383
Myotonic Dystrophy	Associate	36352383
Neoplasm Metastasis	Associate	28653891
Neoplasms	Associate	16638127, 22158273, 22865920, 23729589, 26061431, 31989434, 32341020, 36102738
Neoplasms	Inhibit	31052182, 35345359, 35624179, 35725010
Neuroendocrine Tumors	Associate	30321986
Neurologic Manifestations	Associate	36352383
Obesity	Stimulate	35469824
Osteoporosis	Inhibit	31499747
Osteosarcoma	Associate	23729589
Osteosarcoma	Stimulate	24092570
Ovarian Neoplasms	Associate	32199224
Pancreatic Neoplasms	Associate	20128820, 36102738
Prostatic Neoplasms	Associate	37478850
Pulmonary Disease Chronic Obstructive	Inhibit	15888697
Pulmonary Disease Chronic Obstructive	Associate	28526090
Reperfusion Injury	Inhibit	32426849
Stomach Neoplasms	Associate	35725010, 37415735
Urethral Neoplasms	Associate	31052182
Urethral Neoplasms	Inhibit	35624179
Varicose Veins	Associate	36293392
Vitamin D Deficiency	Inhibit	36430854
Waldenstrom Macroglobulinemia	Associate	20519629

HDAC5 (histone deacetylase 5)