PLA2G4B (phospholipase A2 group IVB)

Gene
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
100137049
Gene name Gene Name - the full gene name approved by the HGNC.
Phospholipase A2 group IVB
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
PLA2G4B
Synonyms (NCBI Gene) Gene synonyms aliases
HsT16992, cPLA2-beta
Chromosome Chromosome number
15
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
15q15.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a member of the cytosolic phospholipase A2 protein family. Phospholipase A2 enzymes hydrolyze the sn-2 bond of phospholipids, releasing lysophospholipids and fatty acids. This enzyme may be associated with mitochondria and early endosome
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(10)
miRTarBase ID miRNA Experiments Reference
MIRT004685 hsa-miR-338-3p Immunoblot, Immunocytochemistry, Luciferase reporter assay, Microarray, qRT-PCR 18991333
MIRT1238706 hsa-miR-4300 CLIP-seq
MIRT1238707 hsa-miR-4687-5p CLIP-seq
MIRT1238708 hsa-miR-920 CLIP-seq
MIRT2070243 hsa-miR-214 CLIP-seq
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide all(30)
GO ID Ontology Definition Evidence Reference
GO:0004622 Function Lysophospholipase activity NAS 10358058
GO:0004623 Function Phospholipase A2 activity IBA 21873635
GO:0005509 Function Calcium ion binding IBA 21873635
GO:0005509 Function Calcium ion binding NAS 10085124
GO:0005544 Function Calcium-dependent phospholipid binding IBA 21873635
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
MIM HGNC e!Ensembl
606088 9036 ENSG00000243708
Protein
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
UniProt ID P0C869
Protein name Cytosolic phospholipase A2 beta (cPLA2-beta) (EC 3.1.1.4) (Lysophospholipase A1 group IVB) (EC 3.1.1.5) (Phospholipase A2 group IVB)
Protein function Calcium-dependent phospholipase A1 and A2 and lysophospholipase that may play a role in membrane phospholipid remodeling. ; [Isoform 3]: Calcium-de
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00168 C2 10 → 114 C2 domain Domain
PF18695 cPLA2_C2 151 → 243 Cytosolic phospholipases A2 C2-domain Domain
PF01735 PLA2_B 297 → 532 Lysophospholipase catalytic domain Family
Tissue specificity TISSUE SPECIFICITY: Widely expressed. Expressed at higher level in brain, heart, liver, cerebellum and pancreas. {ECO:0000269|PubMed:10085124, ECO:0000269|PubMed:10358058, ECO:0000269|PubMed:16617059}.
Sequence 
MAVAEVSRTCLLTVRVLQAHRLPSKDLVTPSDCYVTLWLPTACSHRLQTRTVKNSSSPVW
NQSFHFRIHRQLKNVMELKVFDQDLVTGDDPVLSVLFDAGTLRAGEFRRESFSLSPQGEG
RLEVEFRLQSLADRGEWLVSNGVLVARELSCLHVQLEETGDQKSSEHRVQLVVPGSCEGP
QEASVGTGTFRFHCPACWEQELSIRLQDAPEEQLKAPLSALPSGQVVRLVFPTSQEPLMR
VELKKEAGLRELAVRLGFGPCAEEQAFLSRRKQVVAAALRQALQLDGDLQEDEIPVVAIM
ATGGGIRAMTSLYGQLAGLKELGLLDCVSYITGASGSTWALANLYEDPEWSQKDLAGPTE
LLKTQVTKNKLGVLAPSQLQRYRQELAERARLGYPSCFTNLWALINEALLHDEPHDHKLS
DQREALSHGQNPLPIYCALNTKGQSLTTFEFGEWCEFSPYEVGFPKYGAFIPSELFGSEF
FMGQLMKRLPESRICFLEGIWSNLYAANLQDSLYWASEPSQFWDRWVRNQANLDKEQVPL
LKIEEPPSTAGRIAEFFTDLLTWRPLAQATHNFLRGLHFHKDYFQHPHFSTWKATTLDGL
PNQLTPSEPHLCLLDVGYLINTSCLPLLQPTRDVDLILSLDYNLHGAFQQLQLLGRFCQE
QGIPFPPISPSPEEQLQPRECHTFSDPTCPGAPAVLHFPLVSDSFREYSAPGVRRTPEEA
AAGEVNLSSSDSPYHYTKVTYSQEDVDKLLHLTHYNVCNNQEQLLEALRQAVQRRRQRRP
H
Sequence length 781
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
  KEGG   Reactome
  Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
MAPK signaling pathway
Ras signaling pathway
Phospholipase D signaling pathway
Necroptosis
Vascular smooth muscle contraction
VEGF signaling pathway
Platelet activation
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Glutamatergic synapse
Serotonergic synapse
Long-term depression
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Ovarian steroidogenesis
Oxytocin signaling pathway
Choline metabolism in cancer 		  Acyl chain remodelling of PC
Acyl chain remodelling of PS
Acyl chain remodelling of PE
Acyl chain remodelling of PG
Hydrolysis of LPC
Synthesis of PA
XBP1(S) activates chaperone genes
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Schizophrenia Schizophrenia rs13447324, rs387906932, rs387906933, rs863223354, rs863223355, rs776061422, rs863223349, rs748809996, rs759748655, rs863223353, rs863223350, rs863223356, rs781821239, rs863223348, rs863223346
View all (12 more)		 15999343
Show/Hide Text Mining Associations (3)
Associations from Text Mining
Disease Name Relationship Type References
Inflammation Inhibit 32107839
Metabolic Syndrome Associate 36518097
Squamous Cell Carcinoma of Head and Neck Associate 28030848