KRTAP4-7 (keratin associated protein 4-7)

Gene Gene information from NCBI Gene database.
Gene miRNA Other IDs Protein
Entrez ID 100132476
Gene name Keratin associated protein 4-7
Gene symbol KRTAP4-7
Synonyms (NCBI Gene)
KAP4.7KRTAP4.7
Chromosome 17
Chromosome location 17q21.2
Summary This protein is a member of the keratin-associated protein (KAP) family. The KAP proteins form a matrix of keratin intermediate filaments which contribute to the structure of hair fibers. KAP family members appear to have unique, family-specific amino- an
miRNA miRNA information provided by mirtarbase database.
8
Gene miRNA Other IDs Protein
Show/Hide all (8)
miRTarBase ID miRNA Experiments Reference
MIRT025729 hsa-miR-7-5p Microarray 19073608
MIRT1102079 hsa-miR-1227 CLIP-seq
MIRT1102080 hsa-miR-23a CLIP-seq
MIRT1102081 hsa-miR-23b CLIP-seq
MIRT1102082 hsa-miR-23c CLIP-seq
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Other IDs Protein
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Gene miRNA Other IDs Protein
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9BYR0
Protein name Keratin-associated protein 4-7 (Keratin-associated protein 4.7) (Ultrahigh sulfur keratin-associated protein 4.7)
Protein function In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their e
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF13885 Keratin_B2_2 19 → 68 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 34 → 78 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 54 → 98 Keratin, high sulfur B2 protein Family
PF13885 Keratin_B2_2 99 → 143 Keratin, high sulfur B2 protein Family
Tissue specificity TISSUE SPECIFICITY: Expressed in the hair follicles. {ECO:0000269|PubMed:15955084}.
Sequence 
MVSSCCGSVCSDQGCSQDLCQETCCRPSCCQTTCCRTTCYRPSCCVSSCCRPQCCQSVCC
QPTCCRPTCCETTCCHPRCCISSCCRPSCCMSSCCKPQCCQSVCCQPTCCHPSCCISSCC
RPSCCVSRCCRPQCCQSVCCQPTCCRPSCCISSCCRPSCCESSCCRPSCCRPCCCLRPVC
GRVSCHTTCYRPTCVISTCPRPLCCASSCC
Sequence length 210
Interactions View interactions