SYCE1L (synaptonemal complex central element protein 1 like)

Gene Gene information from NCBI Gene database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID 100130958
Gene name Synaptonemal complex central element protein 1 like
Gene symbol SYCE1L
Synonyms (NCBI Gene)
MRP2
Chromosome 16
Chromosome location 16q23.1
miRNA miRNA information provided by mirtarbase database.
10
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (10)
miRTarBase ID miRNA Experiments Reference
MIRT483147 hsa-miR-493-3p PAR-CLIP 23592263
MIRT483146 hsa-miR-1292-5p PAR-CLIP 23592263
MIRT483144 hsa-miR-4747-5p PAR-CLIP 23592263
MIRT483145 hsa-miR-5196-5p PAR-CLIP 23592263
MIRT483143 hsa-miR-425-3p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
6
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all (6)
GO ID Ontology Definition Evidence Reference
GO:0000795 Component Synaptonemal complex IBA
GO:0000795 Component Synaptonemal complex IEA
GO:0007130 Process Synaptonemal complex assembly IEA
GO:0045111 Component Intermediate filament cytoskeleton IDA
GO:0051321 Process Meiotic cell cycle IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
619954 37236 ENSG00000205078
Protein Protein information from UniProt database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A8MT33
Protein name Synaptonemal complex central element protein 1-like (Meiosis-related protein)
Protein function May be involved in meiosis.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15233 SYCE1 42 → 122 Synaptonemal complex central element protein 1 Coiled-coil
PF15233 SYCE1 118 → 164 Synaptonemal complex central element protein 1 Coiled-coil
Sequence 
MAGKLKPLNVEAPEATEEAEGQAKSLKTEDLLAMVIKLQKEGSLEPQIEDLISRINDLQQ
AKKKSSEELRETHSLWEALHRELDSLNGEKVHLEEVLGKKQEALRILQMHCQEKESEAQR
LDVRGQLEDLMGQHKDLWEFHMLEQRLAREIRALERSKEQLLSERRLVRAKLREVERRLH
SPPEVEGAMAVNDGLKAELEIFGEQVRSAPEVGAGEGEAGPELPRARDEEDPEPPVAAPD
AL
Sequence length 242
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (3)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INSOMNIA — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Non-obstructive azoospermia Benign; Likely benign ClinVar
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations