Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10013
Gene name	Histone deacetylase 6
Gene symbol	HDAC6
Synonyms (NCBI Gene)	CPBHMHD6JM21KDAC6PPP1R90
Chromosome	X
Chromosome location	Xp11.23
Summary	Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein encoded by this gene b

Show/Hide all (45)

miRTarBase ID	miRNA	Experiments	Reference
MIRT017204	hsa-miR-335-5p	Microarray	18185580
MIRT047316	hsa-miR-181a-5p	CLASH	23622248
MIRT052981	hsa-miR-22-3p	Luciferase reporter assayqRT-PCRWestern blot	22375943
MIRT438461	hsa-miR-548m	Luciferase reporter assay	24216476
MIRT438461	hsa-miR-548m	Luciferase reporter assay	24216476
MIRT052981	hsa-miR-22-3p	Luciferase reporter assayWestern blot	28195408
MIRT052981	hsa-miR-22-3p	Luciferase reporter assayWestern blot	28195408
MIRT052981	hsa-miR-22-3p	Western blottingImmunofluorescenceqRT-PCR	32985730
MIRT052981	hsa-miR-22-3p	Western blottingqRT-PCR	32985730
MIRT755705	hsa-miR-34a-5p	Luciferase reporter assayWestern blottingMicroarrayqRT-PCRImmunohistochemistry (IHC)ImmunofluorescenceFlow cytometry	38059122
MIRT1042501	hsa-miR-1	CLIP-seq
MIRT1042502	hsa-miR-1913	CLIP-seq
MIRT1042503	hsa-miR-206	CLIP-seq
MIRT1042504	hsa-miR-22	CLIP-seq
MIRT1042505	hsa-miR-2392	CLIP-seq
MIRT1042506	hsa-miR-3160-3p	CLIP-seq
MIRT1042507	hsa-miR-324-3p	CLIP-seq
MIRT1042508	hsa-miR-3652	CLIP-seq
MIRT1042509	hsa-miR-3673	CLIP-seq
MIRT1042510	hsa-miR-3689a-3p	CLIP-seq
MIRT1042511	hsa-miR-3689c	CLIP-seq
MIRT1042512	hsa-miR-3975	CLIP-seq
MIRT1042513	hsa-miR-4252	CLIP-seq
MIRT1042514	hsa-miR-4260	CLIP-seq
MIRT1042515	hsa-miR-4313	CLIP-seq
MIRT1042516	hsa-miR-4430	CLIP-seq
MIRT1042517	hsa-miR-4438	CLIP-seq
MIRT1042518	hsa-miR-4487	CLIP-seq
MIRT1042519	hsa-miR-4728-5p	CLIP-seq
MIRT1042520	hsa-miR-5095	CLIP-seq
MIRT1042521	hsa-miR-548v	CLIP-seq
MIRT1042522	hsa-miR-556-5p	CLIP-seq
MIRT1042523	hsa-miR-558	CLIP-seq
MIRT1042524	hsa-miR-610	CLIP-seq
MIRT1042525	hsa-miR-613	CLIP-seq
MIRT2009001	hsa-miR-548l	CLIP-seq
MIRT1042502	hsa-miR-1913	CLIP-seq
MIRT1042504	hsa-miR-22	CLIP-seq
MIRT1042506	hsa-miR-3160-3p	CLIP-seq
MIRT1042507	hsa-miR-324-3p	CLIP-seq
MIRT1042513	hsa-miR-4252	CLIP-seq
MIRT1042514	hsa-miR-4260	CLIP-seq
MIRT1042515	hsa-miR-4313	CLIP-seq
MIRT1042518	hsa-miR-4487	CLIP-seq
MIRT1042523	hsa-miR-558	CLIP-seq

170

Show/Hide all (170)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IDA	11948178
GO:0000118	Component	Histone deacetylase complex	IEA
GO:0000209	Process	Protein polyubiquitination	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	24413532
GO:0001222	Function	Transcription corepressor binding	IPI	12535528
GO:0001975	Process	Response to amphetamine	IEA
GO:0003779	Function	Actin binding	IEA
GO:0004407	Function	Histone deacetylase activity	IDA	10220385
GO:0004407	Function	Histone deacetylase activity	IEA
GO:0004407	Function	Histone deacetylase activity	IMP	23322205
GO:0005515	Function	Protein binding	IPI	16919237, 17604723, 17872950, 18356165, 19033385, 19036992, 19081074, 19167333, 19893491, 20029029, 20308065, 21220424, 21532619, 21847094, 21952047, 22193721, 22645275, 23084749, 24658140, 24687993, 25422469, 27556504, 29281743, 31980649, 32814053, 33961781
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	24687993, 26246421
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS	11861901
GO:0005737	Component	Cytoplasm	TAS	19457097
GO:0005771	Component	Multivesicular body	TAS	25548531
GO:0005813	Component	Centrosome	IDA	26246421
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0005874	Component	Microtubule	IDA	12620231
GO:0005875	Component	Microtubule associated complex	IDA	19228685
GO:0005901	Component	Caveola	IDA	18356165
GO:0005929	Component	Cilium	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006476	Process	Protein deacetylation	IDA	28516954
GO:0006511	Process	Ubiquitin-dependent protein catabolic process	IEA
GO:0006515	Process	Protein quality control for misfolded or incompletely synthesized proteins	IMP	14675537
GO:0006886	Process	Intracellular protein transport	IMP	16192271
GO:0006914	Process	Autophagy	IEA
GO:0006950	Process	Response to stress	IEA
GO:0007015	Process	Actin filament organization	IEA
GO:0007026	Process	Negative regulation of microtubule depolymerization	IEA
GO:0007173	Process	Epidermal growth factor receptor signaling pathway	IMP	18356165
GO:0008013	Function	Beta-catenin binding	IPI	18356165
GO:0008017	Function	Microtubule binding	IDA	19228685
GO:0008017	Function	Microtubule binding	IEA
GO:0008017	Function	Microtubule binding	ISS
GO:0008270	Function	Zinc ion binding	IEA
GO:0010506	Process	Regulation of autophagy	TAS	25548531
GO:0010634	Process	Positive regulation of epithelial cell migration	IMP	12024216
GO:0010727	Process	Negative regulation of hydrogen peroxide metabolic process	IMP	18606987
GO:0010821	Process	Regulation of mitochondrion organization	IEA
GO:0010977	Process	Negative regulation of neuron projection development	IEA
GO:0015630	Component	Microtubule cytoskeleton	IEA
GO:0016234	Component	Inclusion body	IDA	16192271
GO:0016235	Component	Aggresome	IDA	14675537
GO:0016235	Component	Aggresome	TAS	19457097
GO:0016236	Process	Macroautophagy	IEA
GO:0016241	Process	Regulation of macroautophagy	IMP	16192271
GO:0016740	Function	Transferase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019213	Function	Deacetylase activity	IBA
GO:0019213	Function	Deacetylase activity	IEA
GO:0019896	Process	Axonal transport of mitochondrion	IEA
GO:0019896	Process	Axonal transport of mitochondrion	IGI	28105056
GO:0019899	Function	Enzyme binding	IPI	19228685
GO:0019899	Function	Enzyme binding	ISS	11861901
GO:0030182	Process	Neuron differentiation	IEA
GO:0030424	Component	Axon	IEA
GO:0030424	Component	Axon	ISS
GO:0030425	Component	Dendrite	IEA
GO:0030425	Component	Dendrite	ISS
GO:0031252	Component	Cell leading edge	IDA	12024216
GO:0031333	Process	Negative regulation of protein-containing complex assembly	IMP	23962722
GO:0031593	Function	Polyubiquitin modification-dependent protein binding	IDA	14675537
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	21753002
GO:0031647	Process	Regulation of protein stability	IMP	23580651
GO:0031648	Process	Protein destabilization	IEA
GO:0032418	Process	Lysosome localization	IMP	16192271
GO:0032461	Process	Positive regulation of protein oligomerization	IEA
GO:0032461	Process	Positive regulation of protein oligomerization	IMP	23962722
GO:0032886	Process	Regulation of microtubule-based process	IEA
GO:0032984	Process	Protein-containing complex disassembly	IEA
GO:0032991	Component	Protein-containing complex	IEA
GO:0033148	Process	Positive regulation of intracellular estrogen receptor signaling pathway	IMP	18316616
GO:0033558	Function	Protein lysine deacetylase activity	IDA	28516954, 31857589
GO:0033558	Function	Protein lysine deacetylase activity	IEA
GO:0033558	Function	Protein lysine deacetylase activity	IMP	18356165, 23962722
GO:0033558	Function	Protein lysine deacetylase activity	TAS	28386764
GO:0034605	Process	Cellular response to heat	TAS
GO:0035902	Process	Response to immobilization stress	IEA
GO:0035967	Process	Cellular response to topologically incorrect protein	IMP	16192271
GO:0035973	Process	Aggrephagy	IDA	17580304, 22017874, 31857589
GO:0036064	Component	Ciliary basal body	IDA	17604723, 26246421
GO:0036479	Function	Peroxidase inhibitor activity	IMP	18606987
GO:0042030	Function	ATPase inhibitor activity	IMP	15916966
GO:0042826	Function	Histone deacetylase binding	IPI	12620231
GO:0042903	Function	Tubulin deacetylase activity	EXP	12024216
GO:0042903	Function	Tubulin deacetylase activity	IDA	12620231, 19228685, 20308065
GO:0042903	Function	Tubulin deacetylase activity	IEA
GO:0042903	Function	Tubulin deacetylase activity	IMP	19457097
GO:0042903	Function	Tubulin deacetylase activity	ISS
GO:0042903	Function	Tubulin deacetylase activity	TAS	19457097
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IEA
GO:0043014	Function	Alpha-tubulin binding	IDA	19228685
GO:0043025	Component	Neuronal cell body	IEA
GO:0043130	Function	Ubiquitin binding	IEA
GO:0043131	Process	Erythrocyte enucleation	IEA
GO:0043162	Process	Ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IEA
GO:0043204	Component	Perikaryon	IEA
GO:0043204	Component	Perikaryon	ISS
GO:0043242	Process	Negative regulation of protein-containing complex disassembly	IMP	15916966
GO:0045598	Process	Regulation of fat cell differentiation	IEA
GO:0045814	Process	Negative regulation of gene expression, epigenetic	IMP	24413532
GO:0045861	Process	Negative regulation of proteolysis	IMP	18356165
GO:0045892	Process	Negative regulation of DNA-templated transcription	ISS	11861901
GO:0046872	Function	Metal ion binding	IEA
GO:0047611	Function	Acetylspermidine deacetylase activity	IDA	28516954
GO:0048156	Function	Tau protein binding	IDA	18636984
GO:0048156	Function	Tau protein binding	IEA
GO:0048156	Function	Tau protein binding	ISS	19457097
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0048156	Function	Tau protein binding	TAS	19457097
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	12024216
GO:0048487	Function	Beta-tubulin binding	IEA
GO:0048668	Process	Collateral sprouting	IEA
GO:0048843	Process	Negative regulation of axon extension involved in axon guidance	IEA
GO:0050775	Process	Positive regulation of dendrite morphogenesis	IEA
GO:0051129	Process	Negative regulation of cellular component organization	IEA
GO:0051130	Process	Positive regulation of cellular component organization	IEA
GO:0051412	Process	Response to corticosterone	IEA
GO:0051646	Process	Mitochondrion localization	IEA
GO:0051787	Function	Misfolded protein binding	EXP	17785525
GO:0051788	Process	Response to misfolded protein	IMP	14675537
GO:0051879	Function	Hsp90 protein binding	IDA	15916966
GO:0051968	Process	Positive regulation of synaptic transmission, glutamatergic	IEA
GO:0060271	Process	Cilium assembly	TAS
GO:0060632	Process	Regulation of microtubule-based movement	IC	19228685
GO:0060765	Process	Regulation of androgen receptor signaling pathway	TAS	18852123
GO:0060997	Process	Dendritic spine morphogenesis	IEA
GO:0061523	Process	Cilium disassembly	IDA	26246421
GO:0061523	Process	Cilium disassembly	IMP	17604723
GO:0061734	Process	Type 2 mitophagy	IGI	20457763
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070201	Process	Regulation of establishment of protein localization	IEA
GO:0070301	Process	Cellular response to hydrogen peroxide	IMP	18606987
GO:0070507	Process	Regulation of microtubule cytoskeleton organization	IEA
GO:0070840	Function	Dynein complex binding	IDA	14675537
GO:0070842	Process	Aggresome assembly	IEA
GO:0070842	Process	Aggresome assembly	IMP	14675537
GO:0070845	Process	Polyubiquitinated misfolded protein transport	IMP	14675537
GO:0071211	Process	Protein targeting to vacuole involved in autophagy	IDA	37802024
GO:0071218	Process	Cellular response to misfolded protein	IEA
GO:0071374	Process	Cellular response to parathyroid hormone stimulus	IEA
GO:0071548	Process	Response to dexamethasone	IEA
GO:0090042	Process	Tubulin deacetylation	IBA
GO:0090042	Process	Tubulin deacetylation	IDA	20308065, 23093407
GO:0090042	Process	Tubulin deacetylation	ISS
GO:0098732	Process	Macromolecule deacylation	IEA
GO:0106047	Process	Polyamine deacetylation	IDA	28516954
GO:0106048	Process	Spermidine deacetylation	IDA	28516954
GO:0120025	Component	Plasma membrane bounded cell projection	IEA
GO:0140694	Process	Membraneless organelle assembly	IDA	29343546, 29507397
GO:0141221	Function	Histone deacetylase activity, hydrolytic mechanism	IEA
GO:1900409	Process	Positive regulation of cellular response to oxidative stress	IEA
GO:1903146	Process	Regulation of autophagy of mitochondrion	TAS	25548531
GO:1904056	Process	Positive regulation of cholangiocyte proliferation	IEA
GO:1904115	Component	Axon cytoplasm	IEA
GO:1905091	Process	Positive regulation of type 2 mitophagy	IEA
GO:1905336	Process	Negative regulation of aggrephagy	IDA	31857589

MIM	HGNC	e!Ensembl
300272	14064	ENSG00000094631

Q9UBN7

Protein name

Protein deacetylase HDAC6 (EC 3.5.1.-) (E3 ubiquitin-protein ligase HDAC6) (EC 2.3.2.-) (Tubulin-lysine deacetylase HDAC6) (EC 3.5.1.-)

Protein function

Deacetylates a wide range of non-histone substrates (PubMed:12024216, PubMed:18606987, PubMed:20308065, PubMed:24882211, PubMed:26246421, PubMed:30538141, PubMed:31857589, PubMed:30770470, PubMed:38534334, PubMed:39567688). Plays a central role

PDB

3C5K , 3GV4 , 3PHD , 5B8D , 5EDU , 5KH3 , 5KH7 , 5KH9 , 5WBN , 5WPB , 6CE6 , 6CE8 , 6CEA , 6CEC , 6CED , 6CEE , 6CEF , 7ZYU , 8G43 , 8G44 , 8G45

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00850	Hist_deacetyl	105 → 402	Histone deacetylase domain	Domain
PF00850	Hist_deacetyl	500 → 798	Histone deacetylase domain	Domain
PF02148	zf-UBP	1133 → 1195	Zn-finger in ubiquitin-hydrolases and other protein	Domain

Sequence

MTSTGQDSTTTRQRRSRQNPQSPPQDSSVTSKRNIKKGAVPRSIPNLAEVKKKGKMKKLG
QAMEEDLIVGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQLI
QEGLLDRCVSFQARFAEKEELMLVHSLEYIDLMETTQYMNEGELRVLADTYDSVYLHPNS
YSCACLASGSVLRLVDAVLGAEIRNGMAIIRPPGHHAQHSLMDGYCMFNHVAVAARYAQQ
KHRIRRVLIVDWDVHHGQGTQFTFDQDPSVLYFSIHRYEQGRFWPHLKASNWSTTGFGQG
QGYTINVPWNQVGMRDADYIAAFLHVLLPVALEFQPQLVLVAAGFDALQGDPKGEMAATP
AGFAQLTHLLMGLAGGKLILSLEGGYNLRALAEGVSASLHTLLGDPCPMLESPGAPCRSA
QASVSCALEALEPFWEVLVRSTETVERDNMEEDNVEESEEEGPWEPPVLPILTWPVLQSR
TGLVYDQNMMNHCNLWDSHHPEVPQRILRIMCRLEELGLAGRCLTLTPRPATEAELLTCH
SAEYVGHLRATEKMKTRELHRESSNFDSIYICPSTFACAQLATGAACRLVEAVLSGEVLN
GAAVVRPPGHHAEQDAACGFCFFNSVAVAARHAQTISGHALRILIVDWDVHHGNGTQHMF
EDDPSVLYVSLHRYDHGTFFPMGDEGASSQIGRAAGTGFTVNVAWNGPRMGDADYLAAWH
RLVLPIAYEFNPELVLVSAGFDAARGDPLGGCQVSPEGYAHLTHLLMGLASGRIILILEG
GYNLTSISESMAACTRSLLGDPPPLLTLPRPPLSGALASITETIQVHRRYWRSLRVMKVE
DREGPSSSKLVTKKAPQPAKPRLAERMTTREKKVLEAGMGKVTSASFGEESTPGQTNSET
AVVALTQDQPSEAATGGATLAQTISEAAIGGAMLGQTTSEEAVGGATPDQTTSEETVGGA
ILDQTTSEDAVGGATLGQTTSEEAVGGATLAQTTSEAAMEGATLDQTTSEEAPGGTELIQ
TPLASSTDHQTPPTSPVQGTTPQISPSTLIGSLRTLELGSESQGASESQAPGEENLLGEA
AGGQDMADSMLMQGSRGLTDQAIFYAVTPLPWCPHLVAVCPIPAAGLDVTQPCGDCGTIQ
ENWVCLSCYQVYCGRYINGHMLQHHGNSGHPLVLSYIDLSAWCYYCQAYVHHQALLDVKN
IAHQNKFGEDMPHPH

Sequence length

1215

Interactions

View interactions

	KEGG		Reactome
	Neutrophil extracellular trap formation Amyotrophic lateral sclerosis Alcoholism Viral carcinogenesis		Constitutive Signaling by NOTCH1 PEST Domain Mutants Constitutive Signaling by NOTCH1 HD+PEST Domain Mutants HSF1 activation Notch-HLH transcription pathway Cilium Assembly Transcriptional regulation by RUNX2 Aggrephagy

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
X-linked dominant chondrodysplasia, Chassaing-Lacombe type	Likely pathogenic; Pathogenic	rs2519445322, rs2519366970, rs398122390	RCV003315278 RCV004584266 RCV000055614

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Abnormality of neuronal migration	Uncertain significance	rs782506012	RCV000201389
HDAC6-related disorder	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign; Benign	rs201845777, rs144699758, rs147652236, rs2519387616, rs61735967, rs782203131, rs782001291, rs41312114, rs138084502, rs143689285, rs371512851, rs782255342	RCV003940883 RCV003953985 RCV003974052 RCV003913814 RCV003972066 RCV003949128 RCV003969679 RCV003935344 RCV003920770 RCV003932915 RCV003902876 RCV003902905
Malignant tumor of esophagus	Uncertain significance	rs782747542	RCV005927149
Thyroid cancer, nonmedullary, 1	Likely benign	rs2519379185	RCV005927651
Usher syndrome	Uncertain significance	rs145223784	RCV003389561

Show/Hide Text Mining Associations (108)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
AA amyloidosis	Associate	37990786
Acute Kidney Injury	Associate	36552715
Adenocarcinoma	Associate	29383752
Alexander Disease	Associate	23634874
Alzheimer Disease	Associate	18636984, 32638097, 37990786
Amyotrophic Lateral Sclerosis	Associate	29021520, 32638097, 33891869, 40333935
Anemia Diamond Blackfan	Associate	34036344
Aortic Valve Calcification of	Associate	30579537
Aortic Valve Stenosis	Inhibit	30579537
Arthritis Rheumatoid	Associate	23632129, 27457515
Arthritis Rheumatoid	Inhibit	34732304
Autism Spectrum Disorder	Associate	23169495
Breast Neoplasms	Associate	19383825, 19744931, 28855742, 32044386
Bulbo Spinal Atrophy X Linked	Associate	24925468
Carcinogenesis	Associate	28599312, 32833118, 35955780
Carcinoma Hepatocellular	Associate	23402884, 35977926
Carcinoma Non Small Cell Lung	Associate	26388610, 27499032
Carcinoma Papillary	Stimulate	23873102
Carcinoma Renal Cell	Associate	25313256, 27506904
Carcinoma Renal Cell	Stimulate	28128740
Cataract	Associate	32985730
Charcot Marie Tooth Disease	Associate	34958183
Cholangiocarcinoma	Associate	29406621
Chordoma	Associate	23893747
Colorectal Neoplasms	Associate	28599312, 32711442, 35247921, 36122629, 36270986
Congenital contractural arachnodactyly	Associate	21750953
Death	Associate	30787326
Diffuse Neurofibrillary Tangles with Calcification	Associate	18636984
Drug Related Side Effects and Adverse Reactions	Inhibit	22047054
Drug Related Side Effects and Adverse Reactions	Associate	27369083
Endometrial Neoplasms	Associate	32107418
Epilepsy Familial Mesial Temporal Lobe	Associate	33258018
Epstein Barr Virus Infections	Associate	19386607
Esophageal Neoplasms	Associate	29665050, 30779074, 30961474
Esophageal Squamous Cell Carcinoma	Associate	23621219, 29665050, 30779074
Fibrosis	Associate	32985730
Glioblastoma	Stimulate	26150340
Glioblastoma	Associate	28735518, 32328646, 35757013
Glioma	Associate	20008322, 25791281, 26524593, 32328646, 37528157
Gliosarcoma	Associate	35757013
Glomerulonephritis IGA	Associate	33896334
Heart Diseases	Associate	30622143
Heredodegenerative Disorders Nervous System	Associate	36135988
HTLV I Infections	Associate	16148047
Hypoxia	Associate	30385847, 30787326, 35840042
Hypoxia	Inhibit	35977926
Hypoxia Brain	Associate	29338172
Infections	Inhibit	16148047
Infections	Associate	36516338
Inflammation	Associate	30622143, 32862739, 34732304, 36167345
Inflammatory Breast Neoplasms	Stimulate	26643555
Influenza Human	Inhibit	36516338
Ischemia	Stimulate	36552715
Ischemia	Associate	37429230
Kidney Diseases	Associate	33896334, 36552715, 37429230
Leukemia	Associate	18591380, 21359182, 22047054
Leukemia Lymphocytic Chronic B Cell	Associate	23108383
Leukemia Myelogenous Chronic BCR ABL Positive	Stimulate	35674911
Leukemia Myeloid Acute	Associate	21359182, 22047054, 22096027, 23167276, 29499113
Lichen Planus Oral	Associate	30329194
Long QT Syndrome	Associate	35840042
Lung Neoplasms	Associate	25946558, 26698121, 27534532, 33162791, 36639650
Lymphoma	Associate	28315173, 32394008
Lymphoma B Cell	Associate	19386607
Lymphoma T Cell Cutaneous	Associate	18671804, 26244872
Melanoma	Associate	21562571, 27502397, 30728070, 37096557
Melanoma	Stimulate	25774669
Mental Disorders	Associate	36902164
Midline granulomatosis	Associate	31989434
Multiple Myeloma	Associate	22384180, 25482492, 25978432, 32350373
Nasopharyngeal Carcinoma	Associate	39174882
Neoplasm Metastasis	Associate	26388610, 27499032, 28599312, 35955780, 36122629
Neoplasm Metastasis	Stimulate	32107418
Neoplasms	Associate	18499657, 21037108, 21847364, 22384180, 23618908, 23873102, 24618845, 25482492, 25774669, 26112958, 26388610, 26502922, 26524593, 27404291, 27499032 View all (14 more)
Neoplasms	Stimulate	29665050, 34314149
Neoplasms	Inhibit	35345359
Neoplasms Squamous Cell	Associate	32833118
Neuroblastoma	Associate	21847364, 25482939
Neurodegenerative Diseases	Associate	18636984, 27404291, 32205467, 33694180, 35476995, 40333935
Neuroinflammatory Diseases	Associate	37990786
Osteoarthritis	Inhibit	30385847
Osteoporosis	Inhibit	30385847
Ovarian Neoplasms	Associate	19010849, 30787326, 35955780, 39513923
Pancreatic Neoplasms	Associate	26502922
Parkinson Disease	Associate	32205467
Peritoneal Fibrosis	Associate	32862739
Peritonitis	Stimulate	32862739
Personality Disorders	Associate	32961679
Plaque Amyloid	Associate	37990786
Polycystic lipomembranous osteodysplasia with sclerosing leukoencephalopathy	Associate	24886140
Precancerous Conditions	Associate	30942624
Prostatic Neoplasms	Associate	24023871, 26112958, 29383752, 32264916, 37143720, 40022828
Prostatitis	Associate	26112958
Recombinant chromosome 8 syndrome	Stimulate	28866885
Rett Syndrome	Associate	29730163
Rhabdomyolysis	Associate	36552715
Rhabdomyosarcoma	Associate	33199827
Squamous Cell Carcinoma of Head and Neck	Associate	27369083, 32961679, 35732647
Stomach Neoplasms	Associate	28222070
Stomach Neoplasms	Inhibit	34232196
Systemic carnitine deficiency	Associate	29021520
Thyroid Diseases	Associate	23873102
Thyroid Neoplasms	Associate	31395086
Triple Negative Breast Neoplasms	Associate	33523897, 40288122
Urethral Neoplasms	Associate	24618845
Urinary Bladder Neoplasms	Associate	36810912
Uterine Cervical Neoplasms	Associate	22994762, 29716651, 32833118
Waardenburg Syndrome Type 2D	Associate	34958183

HDAC6 (histone deacetylase 6)