TCF24 (transcription factor 24)

Gene
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
100129654
Gene name Gene Name - the full gene name approved by the HGNC.
Transcription factor 24
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TCF24
Synonyms (NCBI Gene) Gene synonyms aliases
TCF-24, bHLHa25
Chromosome Chromosome number
8
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
8q13.1
miRNA miRNA information provided by mirtarbase database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(72)
miRTarBase ID miRNA Experiments Reference
MIRT640281 hsa-miR-548ac HITS-CLIP 23824327
MIRT640280 hsa-miR-548bb-3p HITS-CLIP 23824327
MIRT640279 hsa-miR-548d-3p HITS-CLIP 23824327
MIRT640278 hsa-miR-548h-3p HITS-CLIP 23824327
MIRT640277 hsa-miR-548z HITS-CLIP 23824327
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide all(8)
GO ID Ontology Definition Evidence Reference
GO:0000977 Function RNA polymerase II transcription regulatory region sequence-specific DNA binding IBA
GO:0000981 Function DNA-binding transcription factor activity, RNA polymerase II-specific IBA
GO:0003677 Function DNA binding IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005634 Component Nucleus IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene miRNA Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene miRNA Gene ontology Other IDs Protein Associated diseases
UniProt ID Q7RTU0
Protein name Transcription factor 24 (TCF-24)
Protein function Putative transcription factor.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00010 HLH 51 → 102 Helix-loop-helix DNA-binding domain Domain
Sequence 
MDRGRPAGSPLSASAEPAPLAAAIRDSRPGRTGPGPAGPGGGSRSGSGRPAAANAARERS
RVQTLRHAFLELQRTLPSVPPDTKLSKLDVLLLATTYIAHLTRSLQDDAEAPADAGLGAL
RGDGYLHPVKKWPMRSRLYIGATGQFLKHSVSGEKTNHDNTPTDSQP
Sequence length 167
Interactions View interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Gene miRNA Gene ontology Other IDs Protein Associated diseases
Show/Hide Unknown Diseases (1)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Intracranial Aneurysm Intracranial aneurysm N/A N/A GWAS
Show/Hide Text Mining Associations (1)
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Intracranial Aneurysm Associate 35177760