SMIM27 (small integral membrane protein 27)

Gene
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
100129250
Gene name Gene Name - the full gene name approved by the HGNC.
Small integral membrane protein 27
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
SMIM27
Synonyms (NCBI Gene) Gene synonyms aliases
C9orf133, TOPORS-AS1
Chromosome Chromosome number
9
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
9p21.1
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all(1)
GO ID Ontology Definition Evidence Reference
GO:0016021 Component Integral component of membrane IEA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID A0A1B0GUW7
Protein name Small integral membrane protein 27 (TOPORS antisense RNA 1)
Family and domains
Sequence 
MKPVSRRTLDWIYSVLLLAIVLISWGCIIYASMVSARRQLRKKYPDKIFGTNENL
Sequence length 55
Interactions View interactions
Associated diseases Disease information provided by ClinVar, GenCC, and GWAS databases.
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide Causal Diseases (1)
Causal
Disease term Disease name dbSNP ID References
Leukemia Leukemia, Myelocytic, Acute rs121909646, rs121913488, rs587776834, rs752746786, rs869312821, rs767454740, rs1554564297 27903959
Show/Hide Text Mining Associations (3)
Associations from Text Mining
Disease Name Relationship Type References
Neoplasms Inhibit 33820921
Ovarian Neoplasms Associate 33820921
Stomach Neoplasms Associate 29992774