Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene miRNA Gene ontology Other IDs Protein
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.	100125288
Gene name Gene Name - the full gene name approved by the HGNC.	Zinc finger GATA like protein 1
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.	ZGLP1
Synonyms (NCBI Gene) Gene synonyms aliases	GATAD3, GLP-1, GLP1
Chromosome Chromosome number	19
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.	19p13.2

Show/Hide all(34)

miRTarBase ID	miRNA	Experiments
MIRT1512879	hsa-miR-15a	CLIP-seq
MIRT1512880	hsa-miR-15b	CLIP-seq
MIRT1512881	hsa-miR-16	CLIP-seq
MIRT1512882	hsa-miR-1827	CLIP-seq
MIRT1512883	hsa-miR-195	CLIP-seq
MIRT1512884	hsa-miR-214	CLIP-seq
MIRT1512885	hsa-miR-298	CLIP-seq
MIRT1512886	hsa-miR-3612	CLIP-seq
MIRT1512887	hsa-miR-3619-5p	CLIP-seq
MIRT1512888	hsa-miR-424	CLIP-seq
MIRT1512889	hsa-miR-4291	CLIP-seq
MIRT1512890	hsa-miR-4660	CLIP-seq
MIRT1512891	hsa-miR-497	CLIP-seq
MIRT1512892	hsa-miR-646	CLIP-seq
MIRT1512893	hsa-miR-650	CLIP-seq
MIRT1512894	hsa-miR-761	CLIP-seq
MIRT1512895	hsa-miR-922	CLIP-seq
MIRT1512879	hsa-miR-15a	CLIP-seq
MIRT1512880	hsa-miR-15b	CLIP-seq
MIRT1512881	hsa-miR-16	CLIP-seq
MIRT1512882	hsa-miR-1827	CLIP-seq
MIRT1512883	hsa-miR-195	CLIP-seq
MIRT1512884	hsa-miR-214	CLIP-seq
MIRT1512885	hsa-miR-298	CLIP-seq
MIRT1512886	hsa-miR-3612	CLIP-seq
MIRT1512887	hsa-miR-3619-5p	CLIP-seq
MIRT1512888	hsa-miR-424	CLIP-seq
MIRT1512889	hsa-miR-4291	CLIP-seq
MIRT1512890	hsa-miR-4660	CLIP-seq
MIRT1512891	hsa-miR-497	CLIP-seq
MIRT1512892	hsa-miR-646	CLIP-seq
MIRT1512893	hsa-miR-650	CLIP-seq
MIRT1512894	hsa-miR-761	CLIP-seq
MIRT1512895	hsa-miR-922	CLIP-seq

Show/Hide all(24)

GO ID	Ontology	Definition	Evidence
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007283	Process	Spermatogenesis	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0008270	Function	Zinc ion binding	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048477	Process	Oogenesis	IEA
GO:0048599	Process	Oocyte development	IBA
GO:0048599	Process	Oocyte development	IEA
GO:0048599	Process	Oocyte development	ISS

MIM	HGNC	e!Ensembl
611639	37245	ENSG00000220201

Protein

UniProt ID

P0C6A0

Protein name

GATA-type zinc finger protein 1 (GATA-like protein 1) (GLP-1)

Protein function

Transcriptional regulator that plays a key role in germ cell development. Determines the oogenic fate by activating key genes for the oogenic program and meiotic prophase entry. Acts downstream of bone morphogenetic protein (BMP) by regulating e

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00320	GATA	206 → 240	GATA zinc finger	Domain

Sequence

MTEPQVGCVACPRVHKEPAQVGTPWPAKPRSHPRKRDPTALLPRSLWPACQESVTALCFL
QETVERLGQSPAQDTPVLGPCWDPMALGTQGRLLLDRDSKDTQTRISQKGRRLQPPGTPS
APPQRRPRKQLNPCRGTERVDPGFEGVTLKFQIKPDSSLQIIPTYSLPCSSRSQESPADA
VGGPAAHPGGTEAHSAGSEALEPRRCASCRTQRTPLWRDAEDGTPLCNACGIRYKKYGTR
CSSCWLVPRKNVQPKRLCGRCGVSLDPIQEG

Sequence length

271

Interactions

View interactions

ZGLP1 (zinc finger GATA like protein 1)