ZGLP1 (zinc finger GATA like protein 1)

Gene

• Entrez ID: 100125288
• Gene name: Zinc finger GATA like protein 1
• Gene symbol: ZGLP1
• Synonyms (NCBI Gene): GATAD3, GLP-1, GLP1
• Chromosome: 19
• Chromosome location: 19p13.2

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1512879	hsa-miR-15a	CLIP-seq
MIRT1512880	hsa-miR-15b	CLIP-seq
MIRT1512881	hsa-miR-16	CLIP-seq
MIRT1512882	hsa-miR-1827	CLIP-seq
MIRT1512883	hsa-miR-195	CLIP-seq
MIRT1512884	hsa-miR-214	CLIP-seq
MIRT1512885	hsa-miR-298	CLIP-seq
MIRT1512886	hsa-miR-3612	CLIP-seq
MIRT1512887	hsa-miR-3619-5p	CLIP-seq
MIRT1512888	hsa-miR-424	CLIP-seq
MIRT1512889	hsa-miR-4291	CLIP-seq
MIRT1512890	hsa-miR-4660	CLIP-seq
MIRT1512891	hsa-miR-497	CLIP-seq
MIRT1512892	hsa-miR-646	CLIP-seq
MIRT1512893	hsa-miR-650	CLIP-seq
MIRT1512894	hsa-miR-761	CLIP-seq
MIRT1512895	hsa-miR-922	CLIP-seq
MIRT1512879	hsa-miR-15a	CLIP-seq
MIRT1512880	hsa-miR-15b	CLIP-seq
MIRT1512881	hsa-miR-16	CLIP-seq
MIRT1512882	hsa-miR-1827	CLIP-seq
MIRT1512883	hsa-miR-195	CLIP-seq
MIRT1512884	hsa-miR-214	CLIP-seq
MIRT1512885	hsa-miR-298	CLIP-seq
MIRT1512886	hsa-miR-3612	CLIP-seq
MIRT1512887	hsa-miR-3619-5p	CLIP-seq
MIRT1512888	hsa-miR-424	CLIP-seq
MIRT1512889	hsa-miR-4291	CLIP-seq
MIRT1512890	hsa-miR-4660	CLIP-seq
MIRT1512891	hsa-miR-497	CLIP-seq
MIRT1512892	hsa-miR-646	CLIP-seq
MIRT1512893	hsa-miR-650	CLIP-seq
MIRT1512894	hsa-miR-761	CLIP-seq
MIRT1512895	hsa-miR-922	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISS
GO:0003677	Function	DNA binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007283	Process	Spermatogenesis	IBA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0007283	Process	Spermatogenesis	ISS
GO:0008270	Function	Zinc ion binding	IEA
GO:0030154	Process	Cell differentiation	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0048477	Process	Oogenesis	IEA
GO:0048599	Process	Oocyte development	IBA
GO:0048599	Process	Oocyte development	IEA
GO:0048599	Process	Oocyte development	ISS

Other IDs

• MIM: 611639
• HGNC: 37245
• e!Ensembl: ENSG00000220201

Protein

• UniProt ID: P0C6A0
• Protein name: GATA-type zinc finger protein 1 (GATA-like protein 1) (GLP-1)
• Protein function: Transcriptional regulator that plays a key role in germ cell development. Determines the oogenic fate by activating key genes for the oogenic program and meiotic prophase entry. Acts downstream of bone morphogenetic protein (BMP) by regulating e
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00320	GATA	206 → 240	GATA zinc finger	Domain

• Sequence:

  MTEPQVGCVACPRVHKEPAQVGTPWPAKPRSHPRKRDPTALLPRSLWPACQESVTALCFL
  QETVERLGQSPAQDTPVLGPCWDPMALGTQGRLLLDRDSKDTQTRISQKGRRLQPPGTPS
  APPQRRPRKQLNPCRGTERVDPGFEGVTLKFQIKPDSSLQIIPTYSLPCSSRSQESPADA
  VGGPAAHPGGTEAHSAGSEALEPRRCASCRTQRTPLWRDAEDGTPLCNACGIRYKKYGTR
  CSSCWLVPRKNVQPKRLCGRCGVSLDPIQEG

• Sequence length: 271