Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
10010
Gene name Gene Name - the full gene name approved by the HGNC.
TRAF family member associated NFKB activator
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
TANK
Synonyms (NCBI Gene) Gene synonyms aliases
I-TRAF, ITRAF, TRAF2
Chromosome Chromosome number
2
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
2q24.2
Summary Summary of gene provided in NCBI Entrez Gene.
The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. The protein encoded by this gene is found in the cytoplasm and can bind to
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT617696 hsa-miR-329-3p HITS-CLIP 21572407
MIRT617695 hsa-miR-362-3p HITS-CLIP 21572407
MIRT617694 hsa-miR-603 HITS-CLIP 21572407
MIRT617692 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT617691 hsa-miR-3941 HITS-CLIP 21572407
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0004843 Function Cysteine-type deubiquitinase activity IMP 25861989
GO:0005515 Function Protein binding IPI 12005438, 14743216, 17500595, 17568778, 18307994, 20562859, 21212807, 21653829, 21784977, 21903422, 21931555, 21988832, 24008843, 25416956, 25852190, 25861989, 26638075, 28514442, 29251827, 30561431, 32707033, 32814053, 33961781, 34084167
GO:0005737 Component Cytoplasm IDA 21931631
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
603893 11562 ENSG00000136560
Protein
UniProt ID Q92844
Protein name TRAF family member-associated NF-kappa-B activator (TRAF-interacting protein) (I-TRAF)
Protein function Adapter protein involved in I-kappa-B-kinase (IKK) regulation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regulator of TRAF function by maintaining them in a latent state. Blocks TRAF2 binding
PDB 1KZZ , 1L0A , 5H10
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12845 TBD 132 186 TBD domain Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKS
QLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPRK
ETSARSLGSPLLHERGNIEKTFWDLKEEFHKICMLAKAQKDHLSKLNIPDTATETQCSVP
IQCTDK
TDKQEALFKPQAKDDINRGAPSITSVTPRGLCRDEEDTSFESLSKFNVKFPPMD
NDSTFLHSTPERPGILSPATSEAVCQEKFNMEFRDNPGNFVKTEETLFEIQGIDPIASAI
QNLKTTDKTKPSNLVNTCIRTTLDRAACLPPGDHNALYVNSFPLLDPSDAPFPSLDSPGK
AIRGPQQPIWKPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH
FNGET
Sequence length 425
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Autophagy - animal
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases
Lipid and atherosclerosis
  TICAM1-dependent activation of IRF3/IRF7
TRAF6 mediated IRF7 activation
Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Diabetes Type 2 diabetes N/A N/A GWAS
Hypothyroidism Hypothyroidism N/A N/A GWAS
Insomnia Insomnia N/A N/A GWAS
Tourette Syndrome Tourette syndrome N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 23634849
Inflammation Associate 21935477