Gene Gene information from NCBI Gene database.
Entrez ID 10010
Gene name TRAF family member associated NFKB activator
Gene symbol TANK
Synonyms (NCBI Gene)
I-TRAFITRAFTRAF2
Chromosome 2
Chromosome location 2q24.2
Summary The TRAF (tumor necrosis factor receptor-associated factor) family of proteins associate with and transduce signals from members of the tumor necrosis factor receptor superfamily. The protein encoded by this gene is found in the cytoplasm and can bind to
miRNA miRNA information provided by mirtarbase database.
195
miRTarBase ID miRNA Experiments Reference
MIRT617696 hsa-miR-329-3p HITS-CLIP 21572407
MIRT617695 hsa-miR-362-3p HITS-CLIP 21572407
MIRT617694 hsa-miR-603 HITS-CLIP 21572407
MIRT617692 hsa-miR-5011-5p HITS-CLIP 21572407
MIRT617691 hsa-miR-3941 HITS-CLIP 21572407
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
29
GO ID Ontology Definition Evidence Reference
GO:0004843 Function Cysteine-type deubiquitinase activity IMP 25861989
GO:0005515 Function Protein binding IPI 12005438, 14743216, 17500595, 17568778, 18307994, 20562859, 21212807, 21653829, 21784977, 21903422, 21931555, 21988832, 24008843, 25416956, 25852190, 25861989, 26638075, 28514442, 29251827, 30561431, 32707033, 32814053, 33961781, 34084167
GO:0005737 Component Cytoplasm IDA 21931631
GO:0005737 Component Cytoplasm IEA
GO:0005829 Component Cytosol IDA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
603893 11562 ENSG00000136560
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q92844
Protein name TRAF family member-associated NF-kappa-B activator (TRAF-interacting protein) (I-TRAF)
Protein function Adapter protein involved in I-kappa-B-kinase (IKK) regulation which constitutively binds TBK1 and IKBKE playing a role in antiviral innate immunity. Acts as a regulator of TRAF function by maintaining them in a latent state. Blocks TRAF2 binding
PDB 1KZZ , 1L0A , 5H10
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF12845 TBD 132 186 TBD domain Family
Tissue specificity TISSUE SPECIFICITY: Ubiquitous.
Sequence
MDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQQTIIDKLKS
QLLLVNSTQDNNYGCVPLLEDSETRKNNLTLDQPQDKVISGIAREKLPKVRRQEVSSPRK
ETSARSLGSPLLHERGNIEKTFWDLKEEFHKICMLAKAQKDHLSKLNIPDTATETQCSVP
IQCTDK
TDKQEALFKPQAKDDINRGAPSITSVTPRGLCRDEEDTSFESLSKFNVKFPPMD
NDSTFLHSTPERPGILSPATSEAVCQEKFNMEFRDNPGNFVKTEETLFEIQGIDPIASAI
QNLKTTDKTKPSNLVNTCIRTTLDRAACLPPGDHNALYVNSFPLLDPSDAPFPSLDSPGK
AIRGPQQPIWKPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH
FNGET
Sequence length 425
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Autophagy - animal
NOD-like receptor signaling pathway
RIG-I-like receptor signaling pathway
Amyotrophic lateral sclerosis
Pathways of neurodegeneration - multiple diseases
Lipid and atherosclerosis
  TICAM1-dependent activation of IRF3/IRF7
TRAF6 mediated IRF7 activation
Activation of IRF3/IRF7 mediated by TBK1/IKK epsilon
Associated diseases Disease associations from ClinVar categorized as Causal (Pathogenic/Likely Pathogenic) or Unknown.
2
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession
Cervical cancer Benign rs114477833 RCV005903453
Uterine corpus endometrial carcinoma Benign rs114477833 RCV005903454
Associations from Text MiningDisease associations identified through Pubtator
Disease Name Relationship Type References
Breast Neoplasms Associate 23634849
Inflammation Associate 21935477