Gene
Entrez ID Entrez Gene ID - the GENE ID in NCBI Gene database.
1001
Gene name Gene Name - the full gene name approved by the HGNC.
Cadherin 3
Gene symbol Gene Symbol - the official gene symbol approved by the HGNC.
CDH3
Synonyms (NCBI Gene) Gene synonyms aliases
CDHP, HJMD, PCAD
Chromosome Chromosome number
16
Chromosome location Chromosomal Location - indicates the cytogenetic location of the gene or region on the chromosome.
16q22.1
Summary Summary of gene provided in NCBI Entrez Gene.
This gene encodes a classical cadherin of the cadherin superfamily. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature glycoprotein. This cal
SNPs SNP information provided by dbSNP.
SNP ID Visualize variation Clinical significance Consequence
rs36038900 A>C,G Conflicting-interpretations-of-pathogenicity, uncertain-significance, likely-benign Missense variant, coding sequence variant
rs121434542 G>A Pathogenic Coding sequence variant, missense variant
rs121434543 A>G,T Pathogenic Coding sequence variant, missense variant
rs138190335 T>C Conflicting-interpretations-of-pathogenicity, likely-benign, uncertain-significance Coding sequence variant, missense variant
rs144403828 C>T Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, synonymous variant
miRNA miRNA information provided by mirtarbase database.
miRTarBase ID miRNA Experiments Reference
MIRT017451 hsa-miR-335-5p Microarray 18185580
MIRT021364 hsa-miR-9-5p Microarray 17612493
MIRT021719 hsa-miR-132-3p Microarray 17612493
MIRT733635 hsa-miR-665 ELISA, Luciferase reporter assay, Western blotting 33968210
MIRT879841 hsa-miR-1286 CLIP-seq
Transcription factors
Transcription factor Regulation Reference
BRCA1 Repression 22120723
BRCA1 Unknown 19882246
GATA3 Repression 22120723
HOXA9 Unknown 25023983
MYC Unknown 19882246
Gene ontology (GO) Gene ontology information of associated ontologies with gene provided by GO database.
GO ID Ontology Definition Evidence Reference
GO:0000902 Process Cell morphogenesis IBA
GO:0001895 Process Retina homeostasis IMP 23143461
GO:0005509 Function Calcium ion binding IEA
GO:0005737 Component Cytoplasm IBA
GO:0005886 Component Plasma membrane IDA 10460003
Other IDs Other ids provides unique ids of gene in databases such as OMIM, HGNC, ENSEMBLE.
MIM HGNC e!Ensembl
114021 1762 ENSG00000062038
Protein
UniProt ID P22223
Protein name Cadherin-3 (Placental cadherin) (P-cadherin)
Protein function Cadherins are calcium-dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types.
PDB 4OY9 , 4ZML , 4ZMN , 4ZMO , 4ZMP , 4ZMQ , 4ZMT , 4ZMV , 4ZMW , 4ZMX , 4ZMY , 4ZMZ , 5JYL , 5JYM , 6ZTB , 6ZTR , 7CME , 7CMF , 8HYI
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00028 Cadherin 112 206 Cadherin domain Domain
PF00028 Cadherin 220 319 Cadherin domain Domain
PF00028 Cadherin 333 432 Cadherin domain Domain
PF00028 Cadherin 445 539 Cadherin domain Domain
PF01049 Cadherin_C 678 826 Cadherin cytoplasmic region Family
Tissue specificity TISSUE SPECIFICITY: Expressed in some normal epithelial tissues and in some carcinoma cell lines. {ECO:0000269|PubMed:2702654}.
Sequence
MGLPRGPLASLLLLQVCWLQCAASEPCRAVFREAEVTLEAGGAEQEPGQALGKVFMGCPG
QEPALFSTDNDDFTVRNGETVQERRSLKERNPLKIFPSKRILRRHKRDWVVAPISVPENG
KGPFPQRLNQLKSNKDRDTKIFYSITGPGADSPPEGVFAVEKETGWLLLNKPLDREEIAK
YELFGHAVSENGASVEDPMNISIIVT
DQNDHKPKFTQDTFRGSVLEGVLPGTSVMQVTAT
DEDDAIYTYNGVVAYSIHSQEPKDPHDLMFTIHRSTGTISVISSGLDREKVPEYTLTIQA
TDMDGDGSTTTAVAVVEIL
DANDNAPMFDPQKYEAHVPENAVGHEVQRLTVTDLDAPNSP
AWRATYLIMGGDDGDHFTITTHPESNQGILTTRKGLDFEAKNQHTLYVEVTNEAPFVLKL
PTSTATIVVHVE
DVNEAPVFVPPSKVVEVQEGIPTGEPVCVYTAEDPDKENQKISYRILR
DPAGWLAMDPDSGQVTAVGTLDREDEQFVRNNIYEVMVLAMDNGSPPTTGTGTLLLTLI
D
VNDHGPVPEPRQITICNQSPVRQVLNITDKDLSPHTSPFQAQLTDDSDIYWTAEVNEEGD
TVVLSLKKFLKQDTYDVHLSLSDHGNKEQLTVIRATVCDCHGHVETCPGPWKGGFILPVL
GAVLALLFLLLVLLLLVRKKRKIKEPLLLPEDDTRDNVFYYGEEGGGEEDQDYDITQLHR
GLEARPEVVLRNDVAPTIIPTPMYRPRPANPDEIGNFIIENLKAANTDPTAPPYDTLLVF
DYEGSGSDAASLSSLTSSASDQDQDYDYLNEWGSRFKKLADMYGGG
EDD
Sequence length 829
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG   Reactome
  Cell adhesion molecules   Adherens junctions interactions
<
Associated diseases Disease associations categorized as Causal (pathogenic variants), Unknown (uncertain genetic evidence), or Text Mining (literature-based associations)
Causal Diseases caused by PATHOGENIC or LIKELY PATHOGENIC variants from ClinVar only
Disease merge term Disease name dbSNP ID References
Hypotrichosis With Macular Degeneration Congenital hypotrichosis with juvenile macular dystrophy, Hypotrichosis with juvenile macular dystrophy rs752131891, rs1597809479, rs1597817636, rs1597807758, rs724159984, rs1597807897, rs121434542, rs1157108621, rs724159985 N/A
Macular dystrophy macular dystrophy rs724159985 N/A
retinal dystrophy Retinal dystrophy rs1157108621, rs121434542 N/A
Retinitis Pigmentosa retinitis pigmentosa rs1238109100 N/A
Unknown Includes: (1) ClinVar NON-pathogenic variants (Uncertain, Benign, Conflicting, VUS), (2) GenCC associations, (3) GWAS associations, (4) CBGDA evidence-based associations. NOTE: Diseases with pathogenic evidence are excluded to avoid conflicts.
Disease merge term Disease name Evidence References Source
Colorectal Cancer Colorectal cancer N/A N/A GWAS
Inflammatory Bowel Disease Inflammatory bowel disease N/A N/A GWAS
Multiple Sclerosis Multiple sclerosis N/A N/A GWAS
Ulcerative colitis Ulcerative colitis N/A N/A GWAS
Associations from Text Mining Disease associations identified through Pubtator
Disease Name Relationship Type References
Aberrant Crypt Foci Associate 19528483
Adenocarcinoma of Lung Associate 35242247
Adenoma Associate 20087348, 23682078
Alagille Syndrome Associate 14708629
Breast Neoplasms Associate 16115928, 23405208, 33899544
Breast Neoplasms Stimulate 25826086, 35787690
Carcinogenesis Associate 35114976
Carcinoma Hepatocellular Associate 31182916
Carcinoma in Situ Associate 15685613
Carcinoma Non Small Cell Lung Associate 24445599