Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	10008
Gene name	Potassium voltage-gated channel subfamily E regulatory subunit 3
Gene symbol	KCNE3
Synonyms (NCBI Gene)	BRGDA6HOKPPHYPPMiRP2
Chromosome	11
Chromosome location	11q13.4
Summary	Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuro

Show/Hide all (3)

SNP ID	Visualize variation	Clinical significance	Consequence
rs17215437	C>T	Uncertain-significance, likely-benign, conflicting-interpretations-of-pathogenicity, benign, benign-likely-benign	Coding sequence variant, missense variant
rs121908441	C>T	Likely-benign, uncertain-significance, pathogenic	Coding sequence variant, missense variant
rs200856070	T>C	Uncertain-significance, likely-pathogenic	Coding sequence variant, missense variant

218

Show/Hide all (218)

miRTarBase ID	miRNA	Experiments	Reference
MIRT522918	hsa-miR-1247-3p	PAR-CLIP	23446348
MIRT522917	hsa-miR-6134	PAR-CLIP	23446348
MIRT522916	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT522915	hsa-miR-3689d	PAR-CLIP	23446348
MIRT522914	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT522913	hsa-miR-6799-5p	PAR-CLIP	23446348
MIRT522912	hsa-miR-6835-5p	PAR-CLIP	23446348
MIRT522911	hsa-miR-6752-5p	PAR-CLIP	23446348
MIRT522909	hsa-miR-6842-5p	PAR-CLIP	23446348
MIRT522910	hsa-miR-7110-5p	PAR-CLIP	23446348
MIRT522908	hsa-miR-92a-2-5p	PAR-CLIP	23446348
MIRT522907	hsa-miR-4447	PAR-CLIP	23446348
MIRT522906	hsa-miR-4472	PAR-CLIP	23446348
MIRT522905	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT522904	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT522903	hsa-miR-1273e	PAR-CLIP	23446348
MIRT522902	hsa-miR-6751-5p	PAR-CLIP	23446348
MIRT522901	hsa-miR-6803-5p	PAR-CLIP	23446348
MIRT522900	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT522918	hsa-miR-1247-3p	PAR-CLIP	23446348
MIRT522917	hsa-miR-6134	PAR-CLIP	23446348
MIRT522916	hsa-miR-6499-3p	PAR-CLIP	23446348
MIRT522915	hsa-miR-3689d	PAR-CLIP	23446348
MIRT522914	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT522913	hsa-miR-6799-5p	PAR-CLIP	23446348
MIRT522912	hsa-miR-6835-5p	PAR-CLIP	23446348
MIRT522911	hsa-miR-6752-5p	PAR-CLIP	23446348
MIRT522909	hsa-miR-6842-5p	PAR-CLIP	23446348
MIRT522910	hsa-miR-7110-5p	PAR-CLIP	23446348
MIRT522908	hsa-miR-92a-2-5p	PAR-CLIP	23446348
MIRT522907	hsa-miR-4447	PAR-CLIP	23446348
MIRT522906	hsa-miR-4472	PAR-CLIP	23446348
MIRT522905	hsa-miR-6807-5p	PAR-CLIP	23446348
MIRT522904	hsa-miR-455-3p	PAR-CLIP	23446348
MIRT522903	hsa-miR-1273e	PAR-CLIP	23446348
MIRT522902	hsa-miR-6751-5p	PAR-CLIP	23446348
MIRT522901	hsa-miR-6803-5p	PAR-CLIP	23446348
MIRT522900	hsa-miR-6516-5p	PAR-CLIP	23446348
MIRT1080822	hsa-miR-122	CLIP-seq
MIRT1080823	hsa-miR-1224-3p	CLIP-seq
MIRT1080824	hsa-miR-1254	CLIP-seq
MIRT1080825	hsa-miR-125a-3p	CLIP-seq
MIRT1080826	hsa-miR-1284	CLIP-seq
MIRT1080827	hsa-miR-129-5p	CLIP-seq
MIRT1080828	hsa-miR-1297	CLIP-seq
MIRT1080829	hsa-miR-1303	CLIP-seq
MIRT1080830	hsa-miR-1827	CLIP-seq
MIRT1080831	hsa-miR-197	CLIP-seq
MIRT1080832	hsa-miR-2054	CLIP-seq
MIRT1080833	hsa-miR-26a	CLIP-seq
MIRT1080834	hsa-miR-26b	CLIP-seq
MIRT1080835	hsa-miR-300	CLIP-seq
MIRT1080836	hsa-miR-3116	CLIP-seq
MIRT1080837	hsa-miR-3119	CLIP-seq
MIRT1080838	hsa-miR-3122	CLIP-seq
MIRT1080839	hsa-miR-3128	CLIP-seq
MIRT1080840	hsa-miR-3135b	CLIP-seq
MIRT1080841	hsa-miR-3170	CLIP-seq
MIRT1080842	hsa-miR-3187-3p	CLIP-seq
MIRT1080843	hsa-miR-3194-3p	CLIP-seq
MIRT1080844	hsa-miR-3652	CLIP-seq
MIRT1080845	hsa-miR-3663-5p	CLIP-seq
MIRT1080846	hsa-miR-3672	CLIP-seq
MIRT1080847	hsa-miR-3689a-3p	CLIP-seq
MIRT1080848	hsa-miR-3689c	CLIP-seq
MIRT1080849	hsa-miR-381	CLIP-seq
MIRT1080850	hsa-miR-3913-5p	CLIP-seq
MIRT1080851	hsa-miR-3934	CLIP-seq
MIRT1080852	hsa-miR-4423-5p	CLIP-seq
MIRT1080853	hsa-miR-4430	CLIP-seq
MIRT1080854	hsa-miR-4435	CLIP-seq
MIRT1080855	hsa-miR-4440	CLIP-seq
MIRT1080856	hsa-miR-4454	CLIP-seq
MIRT1080857	hsa-miR-4465	CLIP-seq
MIRT1080858	hsa-miR-4474-3p	CLIP-seq
MIRT1080859	hsa-miR-4540	CLIP-seq
MIRT1080860	hsa-miR-4649-3p	CLIP-seq
MIRT1080861	hsa-miR-4666-3p	CLIP-seq
MIRT1080862	hsa-miR-4698	CLIP-seq
MIRT1080863	hsa-miR-4701-5p	CLIP-seq
MIRT1080864	hsa-miR-4716-5p	CLIP-seq
MIRT1080865	hsa-miR-4719	CLIP-seq
MIRT1080866	hsa-miR-4731-3p	CLIP-seq
MIRT1080867	hsa-miR-4755-3p	CLIP-seq
MIRT1080868	hsa-miR-4781-3p	CLIP-seq
MIRT1080869	hsa-miR-4786-5p	CLIP-seq
MIRT1080870	hsa-miR-4789-5p	CLIP-seq
MIRT1080871	hsa-miR-4795-3p	CLIP-seq
MIRT1080872	hsa-miR-4801	CLIP-seq
MIRT1080873	hsa-miR-498	CLIP-seq
MIRT1080874	hsa-miR-5096	CLIP-seq
MIRT1080875	hsa-miR-510	CLIP-seq
MIRT1080876	hsa-miR-512-5p	CLIP-seq
MIRT1080877	hsa-miR-548b-3p	CLIP-seq
MIRT1080878	hsa-miR-548s	CLIP-seq
MIRT1080879	hsa-miR-588	CLIP-seq
MIRT1080880	hsa-miR-649	CLIP-seq
MIRT1080881	hsa-miR-661	CLIP-seq
MIRT1080882	hsa-miR-759	CLIP-seq
MIRT1080883	hsa-miR-764	CLIP-seq
MIRT1080884	hsa-miR-802	CLIP-seq
MIRT1080885	hsa-miR-940	CLIP-seq
MIRT1080822	hsa-miR-122	CLIP-seq
MIRT1080823	hsa-miR-1224-3p	CLIP-seq
MIRT1080825	hsa-miR-125a-3p	CLIP-seq
MIRT1080831	hsa-miR-197	CLIP-seq
MIRT2020033	hsa-miR-1976	CLIP-seq
MIRT2020034	hsa-miR-217	CLIP-seq
MIRT1080840	hsa-miR-3135b	CLIP-seq
MIRT1080841	hsa-miR-3170	CLIP-seq
MIRT1080842	hsa-miR-3187-3p	CLIP-seq
MIRT1080843	hsa-miR-3194-3p	CLIP-seq
MIRT1080844	hsa-miR-3652	CLIP-seq
MIRT1080845	hsa-miR-3663-5p	CLIP-seq
MIRT1080851	hsa-miR-3934	CLIP-seq
MIRT2020035	hsa-miR-4279	CLIP-seq
MIRT2020036	hsa-miR-4418	CLIP-seq
MIRT1080853	hsa-miR-4430	CLIP-seq
MIRT1080854	hsa-miR-4435	CLIP-seq
MIRT1080856	hsa-miR-4454	CLIP-seq
MIRT2020037	hsa-miR-4691-3p	CLIP-seq
MIRT1080863	hsa-miR-4701-5p	CLIP-seq
MIRT1080864	hsa-miR-4716-5p	CLIP-seq
MIRT2020038	hsa-miR-4722-3p	CLIP-seq
MIRT1080867	hsa-miR-4755-3p	CLIP-seq
MIRT2020039	hsa-miR-4772-3p	CLIP-seq
MIRT1080868	hsa-miR-4781-3p	CLIP-seq
MIRT1080870	hsa-miR-4789-5p	CLIP-seq
MIRT1080871	hsa-miR-4795-3p	CLIP-seq
MIRT2020040	hsa-miR-509-3-5p	CLIP-seq
MIRT2020041	hsa-miR-509-5p	CLIP-seq
MIRT1080874	hsa-miR-5096	CLIP-seq
MIRT1080878	hsa-miR-548s	CLIP-seq
MIRT1080879	hsa-miR-588	CLIP-seq
MIRT1080883	hsa-miR-764	CLIP-seq
MIRT1080822	hsa-miR-122	CLIP-seq
MIRT1080823	hsa-miR-1224-3p	CLIP-seq
MIRT1080825	hsa-miR-125a-3p	CLIP-seq
MIRT2251884	hsa-miR-1270	CLIP-seq
MIRT2251885	hsa-miR-150	CLIP-seq
MIRT1080831	hsa-miR-197	CLIP-seq
MIRT2020033	hsa-miR-1976	CLIP-seq
MIRT2020034	hsa-miR-217	CLIP-seq
MIRT1080840	hsa-miR-3135b	CLIP-seq
MIRT1080841	hsa-miR-3170	CLIP-seq
MIRT1080842	hsa-miR-3187-3p	CLIP-seq
MIRT1080843	hsa-miR-3194-3p	CLIP-seq
MIRT1080844	hsa-miR-3652	CLIP-seq
MIRT1080845	hsa-miR-3663-5p	CLIP-seq
MIRT1080851	hsa-miR-3934	CLIP-seq
MIRT2251886	hsa-miR-411	CLIP-seq
MIRT2020035	hsa-miR-4279	CLIP-seq
MIRT2020036	hsa-miR-4418	CLIP-seq
MIRT1080853	hsa-miR-4430	CLIP-seq
MIRT1080854	hsa-miR-4435	CLIP-seq
MIRT1080856	hsa-miR-4454	CLIP-seq
MIRT2251887	hsa-miR-4532	CLIP-seq
MIRT2251888	hsa-miR-4646-5p	CLIP-seq
MIRT2251889	hsa-miR-4683	CLIP-seq
MIRT2251890	hsa-miR-4685-5p	CLIP-seq
MIRT1080863	hsa-miR-4701-5p	CLIP-seq
MIRT1080864	hsa-miR-4716-5p	CLIP-seq
MIRT2020038	hsa-miR-4722-3p	CLIP-seq
MIRT2251891	hsa-miR-4733-3p	CLIP-seq
MIRT1080867	hsa-miR-4755-3p	CLIP-seq
MIRT2020039	hsa-miR-4772-3p	CLIP-seq
MIRT1080868	hsa-miR-4781-3p	CLIP-seq
MIRT2020040	hsa-miR-509-3-5p	CLIP-seq
MIRT2020041	hsa-miR-509-5p	CLIP-seq
MIRT1080874	hsa-miR-5096	CLIP-seq
MIRT1080878	hsa-miR-548s	CLIP-seq
MIRT2251892	hsa-miR-562	CLIP-seq
MIRT1080879	hsa-miR-588	CLIP-seq
MIRT2251893	hsa-miR-620	CLIP-seq
MIRT1080883	hsa-miR-764	CLIP-seq
MIRT2020034	hsa-miR-217	CLIP-seq
MIRT2020036	hsa-miR-4418	CLIP-seq
MIRT2020039	hsa-miR-4772-3p	CLIP-seq
MIRT2020040	hsa-miR-509-3-5p	CLIP-seq
MIRT2020041	hsa-miR-509-5p	CLIP-seq
MIRT1080822	hsa-miR-122	CLIP-seq
MIRT2251885	hsa-miR-150	CLIP-seq
MIRT2555145	hsa-miR-1914	CLIP-seq
MIRT2020033	hsa-miR-1976	CLIP-seq
MIRT2020034	hsa-miR-217	CLIP-seq
MIRT1080840	hsa-miR-3135b	CLIP-seq
MIRT2555146	hsa-miR-3613-3p	CLIP-seq
MIRT1080844	hsa-miR-3652	CLIP-seq
MIRT2555147	hsa-miR-371-5p	CLIP-seq
MIRT2555148	hsa-miR-371b-5p	CLIP-seq
MIRT2020035	hsa-miR-4279	CLIP-seq
MIRT2020036	hsa-miR-4418	CLIP-seq
MIRT1080853	hsa-miR-4430	CLIP-seq
MIRT2251887	hsa-miR-4532	CLIP-seq
MIRT2020038	hsa-miR-4722-3p	CLIP-seq
MIRT2555149	hsa-miR-4797-5p	CLIP-seq
MIRT2555150	hsa-miR-483-3p	CLIP-seq
MIRT2020040	hsa-miR-509-3-5p	CLIP-seq
MIRT2020041	hsa-miR-509-5p	CLIP-seq
MIRT1080822	hsa-miR-122	CLIP-seq
MIRT2555145	hsa-miR-1914	CLIP-seq
MIRT2020033	hsa-miR-1976	CLIP-seq
MIRT2020034	hsa-miR-217	CLIP-seq
MIRT1080840	hsa-miR-3135b	CLIP-seq
MIRT2555146	hsa-miR-3613-3p	CLIP-seq
MIRT1080844	hsa-miR-3652	CLIP-seq
MIRT2555147	hsa-miR-371-5p	CLIP-seq
MIRT2555148	hsa-miR-371b-5p	CLIP-seq
MIRT2020035	hsa-miR-4279	CLIP-seq
MIRT2020036	hsa-miR-4418	CLIP-seq
MIRT1080853	hsa-miR-4430	CLIP-seq
MIRT2251887	hsa-miR-4532	CLIP-seq
MIRT2020038	hsa-miR-4722-3p	CLIP-seq
MIRT2020039	hsa-miR-4772-3p	CLIP-seq
MIRT2555149	hsa-miR-4797-5p	CLIP-seq
MIRT2555150	hsa-miR-483-3p	CLIP-seq
MIRT2020040	hsa-miR-509-3-5p	CLIP-seq
MIRT2020041	hsa-miR-509-5p	CLIP-seq

Show/Hide all (44)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005249	Function	Voltage-gated potassium channel activity	IEA
GO:0005251	Function	Delayed rectifier potassium channel activity	IBA
GO:0005515	Function	Protein binding	IPI	20533308
GO:0005737	Component	Cytoplasm	IDA	12954870
GO:0005737	Component	Cytoplasm	IEA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	IPI	10646604
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0008076	Component	Voltage-gated potassium channel complex	IBA
GO:0008076	Component	Voltage-gated potassium channel complex	IDA	12954870
GO:0008076	Component	Voltage-gated potassium channel complex	IEA
GO:0015459	Function	Potassium channel regulator activity	IBA
GO:0015459	Function	Potassium channel regulator activity	IDA	12954870
GO:0015459	Function	Potassium channel regulator activity	IEA
GO:0016020	Component	Membrane	IEA
GO:0030425	Component	Dendrite	IDA	12954870
GO:0030425	Component	Dendrite	IEA
GO:0030644	Process	Intracellular chloride ion homeostasis	IEA
GO:0031982	Component	Vesicle	IDA	10646604
GO:0032809	Component	Neuronal cell body membrane	IDA	12954870
GO:0042995	Component	Cell projection	IEA
GO:0043204	Component	Perikaryon	IDA	12954870
GO:0043204	Component	Perikaryon	IEA
GO:0043266	Process	Regulation of potassium ion transport	IEA
GO:0044325	Function	Transmembrane transporter binding	IBA
GO:0044325	Function	Transmembrane transporter binding	IEA
GO:0045121	Component	Membrane raft	IDA	20533308
GO:0045121	Component	Membrane raft	IEA
GO:0060307	Process	Regulation of ventricular cardiac muscle cell membrane repolarization	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0086005	Process	Ventricular cardiac muscle cell action potential	IBA
GO:0086011	Process	Membrane repolarization during action potential	IBA
GO:0086091	Process	Regulation of heart rate by cardiac conduction	IBA
GO:0086091	Process	Regulation of heart rate by cardiac conduction	IMP	22987075
GO:0097623	Process	Potassium ion export across plasma membrane	IBA
GO:0098915	Process	Membrane repolarization during ventricular cardiac muscle cell action potential	IEA
GO:1902260	Process	Negative regulation of delayed rectifier potassium channel activity	IDA	12954870
GO:1902282	Function	Voltage-gated potassium channel activity involved in ventricular cardiac muscle cell action potential repolarization	IBA
GO:1903765	Process	Negative regulation of potassium ion export across plasma membrane	IDA	22987075
GO:1905025	Process	Negative regulation of membrane repolarization during ventricular cardiac muscle cell action potential	IMP	22987075
GO:1990794	Component	Basolateral part of cell	IEA

MIM	HGNC	e!Ensembl
604433	6243	ENSG00000175538

Q9Y6H6

Protein name

Potassium voltage-gated channel subfamily E member 3 (MinK-related peptide 2) (MiRP2) (Minimum potassium ion channel-related peptide 2) (Potassium channel subunit beta MiRP2)

Protein function

Ancillary protein that functions as a regulatory subunit of the voltage-gated potassium (Kv) channel complex composed of pore-forming and potassium-conducting alpha subunits and of regulatory beta subunits. KCNE3 beta subunit modulates the gatin

PDB

2NDJ , 6V00 , 6V01

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02060	ISK_Channel	20 → 100	Slow voltage-gated potassium channel	Family

Tissue specificity

TISSUE SPECIFICITY: Expressed in hippocampal neurons (at protein level) (PubMed:12954870). Widely expressed with highest levels in kidney and moderate levels in small intestine. {ECO:0000269|PubMed:10646604, ECO:0000269|PubMed:12954870}.

Sequence

METTNGTETWYESLHAVLKALNATLHSNLLCRPGPGLGPDNQTEERRASLPGRDDNSYMY
ILFVMFLFAVTVGSLILGYTRSRKVDKRSDPYHVYIKNRVSMI

Sequence length

103

Interactions

View interactions

	KEGG		Reactome
	Protein digestion and absorption		Phase 3 - rapid repolarisation Phase 2 - plateau phase

137

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession
Unknown Diseases with uncertain, conflicting, or no pathogenic evidence in ClinVar
Brugada syndrome	Conflicting classifications of pathogenicity; Likely benign; Uncertain significance	rs121908441, rs41315535, rs757362085, rs113583236, rs764717543, rs886048651, rs60016728	RCV000171754 RCV000294920 RCV000304883 RCV000331761 RCV000279697 RCV000395884 RCV000285038 RCV000340003 RCV000386156 RCV000277856 RCV000395528
Brugada syndrome 6	Uncertain significance; Conflicting classifications of pathogenicity; Likely benign; Benign	rs760938276, rs755300564, rs2135004460, rs199972628, rs768106696, rs114110954, rs115848768, rs2135004508, rs764834315, rs565287436, rs17215437, rs1485350191, rs2135003784, rs772286478, rs748308590 View all (43 more)	RCV001338293 RCV001345442 RCV001361464 RCV001400973 RCV001504917 RCV002501980 RCV002506725 RCV002007952 RCV001971450 RCV001913329 RCV001918175 RCV001980459 RCV002161896 RCV003505243 RCV003505245 RCV003774303 RCV003774304 RCV003505263 RCV003614165 RCV003134436 RCV003505285 RCV005058834 RCV003102923 RCV005098307 RCV000799497 RCV000530336 RCV003067434 RCV001852076 RCV003080219 RCV002602780 RCV002592311 RCV003107075 RCV003107076 RCV002663487 RCV000005880 RCV002903659 RCV002971763 RCV000999778 RCV001047989 RCV003615209 RCV003876441 RCV003881947 RCV003505115 RCV002059740 RCV001058599 RCV001243561 RCV000531823 RCV002531805 RCV001860489 RCV000647296 RCV000647295 RCV000647293 RCV000647294 RCV000706541 RCV000692580 RCV000815401 RCV000866332 RCV001045984 RCV001303992 RCV001300353 RCV001308599
Cardiovascular phenotype	Conflicting classifications of pathogenicity; Likely benign; Uncertain significance; Benign	rs755300564, rs199972628, rs17215437, rs1485350191, rs1863847241, rs772286478, rs748308590, rs1863848759, rs17215444, rs780882536, rs1009916288, rs1863843783, rs2496084723, rs2496084597, rs778413540 View all (41 more)	RCV003382542 RCV002438924 RCV002425221 RCV002423202 RCV002342230 RCV002434889 RCV002371534 RCV002374130 RCV002389197 RCV002389200 RCV002401050 RCV002407838 RCV002404056 RCV002450232 RCV002431163 RCV002421704 RCV002459714 RCV002459871 RCV002441538 RCV002439710 RCV002441965 RCV002435100 RCV002453583 RCV004020037 RCV005587305 RCV004629155 RCV005356287 RCV004066826 RCV000618438 RCV004066133 RCV004080774 RCV003167959 RCV000245979 RCV000251523 RCV003382364 RCV004992761 RCV004406036 RCV004406037 RCV004521396 RCV004521397 RCV004521398 RCV004521399 RCV004521400 RCV002429414 RCV002402224 RCV002436368 RCV002384193 RCV000619567 RCV000618816 RCV002360485 RCV003380663 RCV002358849 RCV002332510 RCV003380747 RCV002453964 RCV006347338 RCV002447233 RCV002447285 RCV005367826
KCNE3-related disorder	Likely benign; Benign	rs768106696, rs547401786	RCV003900747 RCV003895173
Long QT syndrome	Conflicting classifications of pathogenicity; Uncertain significance	rs139040374, rs556647231	RCV003318372 RCV003318400
Prolonged QT interval	Conflicting classifications of pathogenicity; Uncertain significance	rs542842233, rs1863849560	RCV001248783 RCV001248794

Show/Hide Text Mining Associations (13)

Disease Name	Relationship Type	References
Associations from Text MiningDisease associations identified through Pubtator
Atrial Fibrillation	Associate	21924735, 21967835
Brugada Syndrome	Associate	19122847, 21967835, 31627867
Cerebrovascular Disorders	Associate	27716384
Colitis Ulcerative	Associate	26718405
Colorectal Neoplasms	Associate	37535601
Cushing's symphalangism	Associate	27716384
Diarrhea	Associate	26718405
Heart Diseases	Associate	21967835
Long QT Syndrome	Associate	21967835
Meniere Disease	Associate	31058602
Neoplasms	Associate	27716384
Tinnitus	Associate	21899751
Vascular Malformations	Associate	27716384

KCNE3 (potassium voltage-gated channel subfamily E regulatory subunit 3)