Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	84186
Gene name	Zinc finger CCHC-type containing 7
Gene symbol	ZCCHC7
Synonyms (NCBI Gene)	AIR1HSPC086
Chromosome	9
Chromosome location	9p13.2

75 Show/Hide all (75)

miRTarBase ID	miRNA	Experiments	Reference
MIRT044027	hsa-miR-365a-3p	CLASH	23622248
MIRT439245	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT439245	ebv-miR-BART7-3p	HITS-CLIP	22473208
MIRT1507421	hsa-miR-1272	CLIP-seq
MIRT1507422	hsa-miR-127-5p	CLIP-seq
MIRT1507423	hsa-miR-3127-5p	CLIP-seq
MIRT1507424	hsa-miR-3158-3p	CLIP-seq
MIRT1507425	hsa-miR-3918	CLIP-seq
MIRT1507426	hsa-miR-3938	CLIP-seq
MIRT1507427	hsa-miR-425	CLIP-seq
MIRT1507428	hsa-miR-628-5p	CLIP-seq
MIRT1507429	hsa-miR-670	CLIP-seq
MIRT2152847	hsa-miR-3660	CLIP-seq
MIRT2152848	hsa-miR-3973	CLIP-seq
MIRT2152849	hsa-miR-4256	CLIP-seq
MIRT2152850	hsa-miR-4526	CLIP-seq
MIRT2152851	hsa-miR-4699-5p	CLIP-seq
MIRT2152852	hsa-miR-549	CLIP-seq
MIRT2152853	hsa-miR-578	CLIP-seq
MIRT2373198	hsa-miR-128	CLIP-seq
MIRT2373199	hsa-miR-154	CLIP-seq
MIRT2373200	hsa-miR-3646	CLIP-seq
MIRT2152847	hsa-miR-3660	CLIP-seq
MIRT2373201	hsa-miR-3926	CLIP-seq
MIRT2152850	hsa-miR-4526	CLIP-seq
MIRT2373202	hsa-miR-4753-5p	CLIP-seq
MIRT2152852	hsa-miR-549	CLIP-seq
MIRT2666048	hsa-miR-1243	CLIP-seq
MIRT2666049	hsa-miR-1245	CLIP-seq
MIRT2666050	hsa-miR-1253	CLIP-seq
MIRT1507422	hsa-miR-127-5p	CLIP-seq
MIRT2373199	hsa-miR-154	CLIP-seq
MIRT2666051	hsa-miR-2052	CLIP-seq
MIRT2666052	hsa-miR-2355-3p	CLIP-seq
MIRT2666053	hsa-miR-3074-5p	CLIP-seq
MIRT2666054	hsa-miR-3117-5p	CLIP-seq
MIRT1507423	hsa-miR-3127-5p	CLIP-seq
MIRT1507424	hsa-miR-3158-3p	CLIP-seq
MIRT2666055	hsa-miR-3168	CLIP-seq
MIRT2666056	hsa-miR-3613-3p	CLIP-seq
MIRT2666057	hsa-miR-3654	CLIP-seq
MIRT1507425	hsa-miR-3918	CLIP-seq
MIRT2666058	hsa-miR-3925-5p	CLIP-seq
MIRT1507426	hsa-miR-3938	CLIP-seq
MIRT2666059	hsa-miR-4307	CLIP-seq
MIRT2666060	hsa-miR-4645-3p	CLIP-seq
MIRT2666061	hsa-miR-4646-3p	CLIP-seq
MIRT2666062	hsa-miR-4696	CLIP-seq
MIRT2152851	hsa-miR-4699-5p	CLIP-seq
MIRT2666063	hsa-miR-4703-3p	CLIP-seq
MIRT2666064	hsa-miR-4712-3p	CLIP-seq
MIRT2666065	hsa-miR-4729	CLIP-seq
MIRT2666066	hsa-miR-4742-3p	CLIP-seq
MIRT2666067	hsa-miR-486-5p	CLIP-seq
MIRT2666068	hsa-miR-494	CLIP-seq
MIRT2666069	hsa-miR-548c-3p	CLIP-seq
MIRT1507428	hsa-miR-628-5p	CLIP-seq
MIRT1507429	hsa-miR-670	CLIP-seq
MIRT2666048	hsa-miR-1243	CLIP-seq
MIRT2666050	hsa-miR-1253	CLIP-seq
MIRT1507422	hsa-miR-127-5p	CLIP-seq
MIRT2373199	hsa-miR-154	CLIP-seq
MIRT2666053	hsa-miR-3074-5p	CLIP-seq
MIRT2666055	hsa-miR-3168	CLIP-seq
MIRT2666056	hsa-miR-3613-3p	CLIP-seq
MIRT2666057	hsa-miR-3654	CLIP-seq
MIRT2666058	hsa-miR-3925-5p	CLIP-seq
MIRT2666062	hsa-miR-4696	CLIP-seq
MIRT2666063	hsa-miR-4703-3p	CLIP-seq
MIRT2666064	hsa-miR-4712-3p	CLIP-seq
MIRT2666065	hsa-miR-4729	CLIP-seq
MIRT2666066	hsa-miR-4742-3p	CLIP-seq
MIRT2666067	hsa-miR-486-5p	CLIP-seq
MIRT2666069	hsa-miR-548c-3p	CLIP-seq
MIRT1507428	hsa-miR-628-5p	CLIP-seq

17 Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674
GO:0003723	Function	RNA binding	IBA
GO:0005515	Function	Protein binding	IPI	25416956, 25556234, 32296183
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0005829	Component	Cytosol	IDA
GO:0008270	Function	Zinc ion binding	IEA
GO:0031499	Component	TRAMP complex	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0071031	Process	Nuclear mRNA surveillance of mRNA 3'-end processing	IBA
GO:0071035	Process	Nuclear polyadenylation-dependent rRNA catabolic process	IBA
GO:0071036	Process	Nuclear polyadenylation-dependent snoRNA catabolic process	IBA
GO:0071037	Process	Nuclear polyadenylation-dependent snRNA catabolic process	IBA
GO:0071038	Process	TRAMP-dependent tRNA surveillance pathway	IBA
GO:0071039	Process	Nuclear polyadenylation-dependent CUT catabolic process	IBA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q8N3Z6

Protein name

Zinc finger CCHC domain-containing protein 7 (TRAMP-like complex RNA-binding factor ZCCHC7)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00098	zf-CCHC	241 → 258	Zinc knuckle	Domain

Sequence

MMFGGYETIEAYEDDLYRDESSSELSVDSEVEFQLYSQIHYAQDLDDVIREEEHEEKNSG
NSESSSSKPNQKKLIVLSDSEVIQLSDGSEVITLSDEDSIYRCKGKNVRVQAQENAHGLS
SSLQSNELVDKKCKSDIEKPKSEERSGVIREVMIIEVSSSEEEESTISEGDNVESWMLLG
CEVDDKDDDILLNLVGCENSVTEGEDGINWSISDKDIEAQIANNRTPGRWTQRYYSANKN
IICRNCDKRGHLSKNCPLPRKVRRCFLCSRRGHLLYSCPAPLCEYCPVPKMLDHSCLFRH
SWDKQCDRCHMLGHYTDACTEIWRQYHLTTKPGPPKKPKTPSRPSALAYCYHCAQKGHYG
HECPEREVYDPSPVSPFICYYDDKYEIQEREKRLKQKIKVLKKNGVIPEPSKLPYIKAAN
ENPHHDIRKGRASWKSNRWPQENKETQKEMKNKNRNWEKHRKADRHREVDEDFPRGPKTY
SSPGSFKTQKPSKPFHRSSHYHTSREDKSPKEGKRGKQKKKERCWEDDDNDNLFLIKQRK
KKS

Sequence length

543

Interactions

View interactions

KEGG Pathway
RNA degradation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (17)
ANOREXIA NERVOSA	—	GWAS catalog	31835028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASPHYXIA NEONATORUM	—	GWAS catalog	34985809	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	31835028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	31835028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	31043756, 31835028, 31926635, 38154582	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	30595370	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	38154582	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	39046104	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSIVE DISORDER	—	GWAS catalog	34985809	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	38965376	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	31835028, 31926635, 33479212, 34045744, 34586374, 34924174, 36738649, 38177345, 41233554	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBSESSIVE-COMPULSIVE DISORDER	—	GWAS catalog	31835028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	40205036	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	31835028, 35396580, 36738649	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TOURETTE SYNDROME	—	GWAS catalog	31835028	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	36738649, 39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining Show/Hide Text Mining Associations (9)
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	28476192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	28476192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	10825588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar Disorder	GWASCAT_DG	31043756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cardiovascular Diseases	Cardiovascular Diseases	GWASCAT_DG	30595370		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	28476192		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10825588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	38049665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	33878706	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZCCHC7 (zinc finger CCHC-type containing 7)

Bookmark This Gene