WNT2 (Wnt family member 2)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7472
• Gene name: Wnt family member 2
• Gene symbol: WNT2
• Synonyms (NCBI Gene): INT1L1, IRP
• Chromosome: 7
• Chromosome location: 7q31.2
• Summary: This gene is a member of the WNT gene family. The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulat

miRNA Show/Hide all (28)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025070	hsa-miR-181a-5p	Microarray	17612493
MIRT438595	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT438595	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT438595	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT438595	hsa-miR-199a-5p	ChIP-seq, FACS, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23764775
MIRT438595	hsa-miR-199a-5p	Luciferase reporter assay, Next Generation Sequencing (NGS), qRT-PCR, Western blot	25596533
MIRT732830	hsa-miR-30a-3p	Immunofluorescence, Luciferase reporter assay, RNA-seq, Western blotting	33397440
MIRT755966	hsa-miR-320e	Luciferase reporter assay, Western blotting, qRT-PCR	37771642
MIRT1493629	hsa-miR-1321	CLIP-seq
MIRT1493630	hsa-miR-1468	CLIP-seq
MIRT1493631	hsa-miR-3160-5p	CLIP-seq
MIRT1493632	hsa-miR-4270	CLIP-seq
MIRT1493633	hsa-miR-4441	CLIP-seq
MIRT1493634	hsa-miR-4511	CLIP-seq
MIRT1493635	hsa-miR-452	CLIP-seq
MIRT1493636	hsa-miR-4676-3p	CLIP-seq
MIRT1493637	hsa-miR-4693-5p	CLIP-seq
MIRT1493638	hsa-miR-4739	CLIP-seq
MIRT1493639	hsa-miR-4756-5p	CLIP-seq
MIRT1493640	hsa-miR-548b-3p	CLIP-seq
MIRT2148786	hsa-miR-1305	CLIP-seq
MIRT2369180	hsa-miR-296-5p	CLIP-seq
MIRT2463529	hsa-miR-2053	CLIP-seq
MIRT2463530	hsa-miR-569	CLIP-seq
MIRT2463529	hsa-miR-2053	CLIP-seq
MIRT2463530	hsa-miR-569	CLIP-seq
MIRT2463529	hsa-miR-2053	CLIP-seq
MIRT2463530	hsa-miR-569	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
PITX2	Unknown	23250740

Gene ontology (GO) Show/Hide all (55)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002053	Process	Positive regulation of mesenchymal cell proliferation	IEA
GO:0002088	Process	Lens development in camera-type eye	ISS	16258938
GO:0005102	Function	Signaling receptor binding	IEA
GO:0005109	Function	Frizzled binding	IBA
GO:0005109	Function	Frizzled binding	IPI	10557084, 19038973
GO:0005125	Function	Cytokine activity	IBA
GO:0005125	Function	Cytokine activity	IDA	10557084
GO:0005515	Function	Protein binding	IPI	10347172, 28514442, 33961781
GO:0005576	Component	Extracellular region	IDA	19038973
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	NAS	2971536
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005737	Component	Cytoplasm	IDA	19038973, 19239325, 23610556
GO:0007267	Process	Cell-cell signaling	IDA	10557084
GO:0008284	Process	Positive regulation of cell population proliferation	IDA	10347172
GO:0010463	Process	Mesenchymal cell proliferation	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0022008	Process	Neurogenesis	TAS	24431302
GO:0030182	Process	Neuron differentiation	IBA
GO:0030182	Process	Neuron differentiation	ISS
GO:0031012	Component	Extracellular matrix	IDA	15507471
GO:0033278	Process	Cell proliferation in midbrain	IDA	20018874
GO:0033278	Process	Cell proliferation in midbrain	IEA
GO:0045165	Process	Cell fate commitment	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	10557084, 20018874
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0048018	Function	Receptor ligand activity	IDA	10557084
GO:0048018	Function	Receptor ligand activity	IMP	17948129
GO:0048146	Process	Positive regulation of fibroblast proliferation	IMP	19734317
GO:0048513	Process	Animal organ development	IEA
GO:0048731	Process	System development	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0050679	Process	Positive regulation of epithelial cell proliferation	IEA
GO:0050769	Process	Positive regulation of neurogenesis	IEA
GO:0055009	Process	Atrial cardiac muscle tissue morphogenesis	IEA
GO:0060038	Process	Cardiac muscle cell proliferation	IEA
GO:0060045	Process	Positive regulation of cardiac muscle cell proliferation	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IBA
GO:0060070	Process	Canonical Wnt signaling pathway	IDA	10347172, 10557084, 20018874
GO:0060070	Process	Canonical Wnt signaling pathway	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	IMP	17948129
GO:0060070	Process	Canonical Wnt signaling pathway	TAS	24431302
GO:0060317	Process	Cardiac epithelial to mesenchymal transition	IEA
GO:0060492	Process	Lung induction	IEA
GO:0060501	Process	Positive regulation of epithelial cell proliferation involved in lung morphogenesis	IEA
GO:0060502	Process	Epithelial cell proliferation involved in lung morphogenesis	IEA
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0061072	Process	Iris morphogenesis	ISS	16258938
GO:0061180	Process	Mammary gland epithelium development	IEP	8168088
GO:0071300	Process	Cellular response to retinoic acid	ISS
GO:0071560	Process	Cellular response to transforming growth factor beta stimulus	IEP	15040835
GO:1904948	Process	Midbrain dopaminergic neuron differentiation	IDA	20018874
GO:1990909	Component	Wnt signalosome	IC	10557084

Other IDs

• MIM: 147870
• HGNC: 12780
• e!Ensembl: ENSG00000105989

Protein

• UniProt ID: P09544
• Protein name: Protein Wnt-2 (Int-1-like protein 1) (Int-1-related protein) (IRP)
• Protein function: Ligand for members of the frizzled family of seven transmembrane receptors. Functions in the canonical Wnt signaling pathway that results in activation of transcription factors of the TCF/LEF family (PubMed:20018874). Functions as a upstream reg
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00110	wnt	43 → 349	wnt family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in brain in the thalamus, in fetal and adult lung and in placenta. {ECO:0000269|PubMed:11449391}.
• Sequence:

  MNAPLGGIWLWLPLLLTWLTPEVNSSWWYMRATGGSSRVMCDNVPGLVSSQRQLCHRHPD
  VMRAISQGVAEWTAECQHQFRQHRWNCNTLDRDHSLFGRVLLRSSRESAFVYAISSAGVV
  FAITRACSQGEVKSCSCDPKKMGSAKDSKGIFDWGGCSDNIDYGIKFARAFVDAKERKGK
  DARALMNLHNNRAGRKAVKRFLKQECKCHGVSGSCTLRTCWLAMADFRKTGDYLWRKYNG
  AIQVVMNQDGTGFTVANERFKKPTKNDLVYFENSPDYCIRDREAGSLGTAGRVCNLTSRG
  MDSCEVMCCGRGYDTSHVTRMTKCGCKFHWCCAVRCQDCLEALDVHTCKAPKNADWTTAT
  

• Sequence length: 360

Pathways

KEGG Pathway	Reactome Pathway
mTOR signaling pathway	WNT ligand biogenesis and trafficking
Wnt signaling pathway
Hippo signaling pathway
Signaling pathways regulating pluripotency of stem cells
Melanogenesis
Cushing syndrome
Alzheimer disease
Pathways of neurodegeneration - multiple diseases
Human papillomavirus infection
Pathways in cancer
Proteoglycans in cancer
Basal cell carcinoma
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	11449391, 19895723	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	21732829, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE CERVICAL NEOPLASMS	—	CTD	25061499	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	31649266, 34594039, 40050615, 40069456	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (105)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	29393333		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	31468733		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10507776		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	28553956		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	16850017		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	29505605	Associate	★☆☆☆☆ Found in Text Mining only
Auditory Perceptual Disorders	Auditory perceptual disorder	Pubtator	28081867	Inhibit	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorder	Autism	Pubtator	34862305	Associate	★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	21575668, 28081867		★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	11449391, 11840514, 15048648, 17330859, 19895723, 21575668, 22522212		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	CTD_human_DG	11449391, 19895723		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	LHGDN	15048648		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	19895723, 28081867	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	BEFREE	16407829		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	11712082, 15736421, 25941337, 30791958		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	15736421, 21772333	Associate	★☆☆☆☆ Found in Text Mining only
Bronchopulmonary Dysplasia	Bronchopulmonary dysplasia	Pubtator	30459472	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15736421	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	31667643, 8552386, 8813115		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28328801, 31322232	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33804101	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	29207102	Associate	★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	23421845		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	CTD_human_DG	25061499		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27513465		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27513465		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	19816559		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	12147710, 31667643		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	29393333	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11605001, 14533014, 26484565, 28553956, 30191337, 31468733, 31667643, 8552386		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	12147710, 18600204, 24504536, 26484565, 29202761, 31468733, 31667643, 33155209, 33891491, 35448980, 36734282, 37374338	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	17534895		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	27545647		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31497214		★☆☆☆☆ Found in Text Mining only
Craniosynostoses	Craniosynostosis	Pubtator	22028906	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	2565082, 2777258, 2902786, 8268652		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	2565082, 2902786	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28860123		★☆☆☆☆ Found in Text Mining only
Donohue Syndrome	Donohue syndrome	Pubtator	20033851	Associate	★☆☆☆☆ Found in Text Mining only
Dupuytren Contracture	Dupuytren Contracture	GWASCAT_DG	21732829		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dupuytren Contracture	Dupuytren contracture	Pubtator	21732829	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dupuytren`s Disease	Dupuytren Contracture	GWASDB_DG	21732829		★☆☆☆☆ Found in Text Mining only
Embryonal Rhabdomyosarcoma	Embryonal Rhabdomyosarcoma	BEFREE	20829439		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	9099960		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	9099960	Inhibit	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	22259059	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Achalasia	Achalasia	BEFREE	27420913, 29113005		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22499122, 26045816	Associate	★☆☆☆☆ Found in Text Mining only
Factor V Deficiency	Factor v deficiency	Pubtator	20364084	Associate	★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	8168088, 8813115		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	27545991		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	26811050		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal Neoplasms	LHGDN	14533014		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31504670		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31504670		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	29152149		★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	27545647		★☆☆☆☆ Found in Text Mining only
Hemochromatosis	Hemochromatosis	Pubtator	12393473, 9116301, 9516158	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary hemochromatosis	Hereditary Hemochromatosis	BEFREE	16503547		★☆☆☆☆ Found in Text Mining only
Heterotaxy Syndrome	Heterotaxy syndrome	Pubtator	26111189	Associate	★☆☆☆☆ Found in Text Mining only
Hyperferritinemia hereditary with congenital cataracts	Hyperferritinemia	Pubtator	10473603	Associate	★☆☆☆☆ Found in Text Mining only
Hyperferritinemia, hereditary, with congenital cataracts	Hereditary hyperferritinemia with congenital cataracts	BEFREE	16850017		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	29207102	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	34274970	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	11605001		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26968103, 28328801, 31322232		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28328801		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	12937339	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21319141, 27513465, 31468733	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	11712082, 15736421, 25941337, 30791958		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	14533014		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31774184		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	15896469, 30127872, 9824203		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11712082, 12147710, 15736421, 17127713, 20405006, 26484565, 28553956, 28665975, 30127872, 30191337, 30867698, 31126892, 8813115		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27513465		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	12147710, 31667643		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11712082		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	8813115		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	15496960, 8962127		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	19332774	Stimulate	★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	LHGDN	15900580		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	29890129		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11605001, 14533014, 15252854, 17127713, 18949017, 18999877, 26968103, 28553956, 31468733, 8168088, 8552386, 8813115		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16850017		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	28665975		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	28665975	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	23250740	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31774184		★☆☆☆☆ Found in Text Mining only
PARKINSON DISEASE, LATE-ONSET	Parkinson disease	BEFREE	29363326		★☆☆☆☆ Found in Text Mining only
Peritoneal Fibrosis	Peritoneal Fibrosis	BEFREE	29363326		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	22489561		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18478098	Associate	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	31497214		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	20829439		★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	28328801	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	20492734		★☆☆☆☆ Found in Text Mining only
Speech Delay	Speech Delay	BEFREE	22522212		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	19857041, 22499122		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30127872, 9824203		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15896469, 16132582, 18184402		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	33002344, 35929139, 39616478	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	LHGDN	15878915		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	CTD_human_DG	25061499		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	21319141, 32058219	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27513465	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

WNT7B 1 shared diseaseDupuytren contracture 12 shared pathwaysmTOR signaling pathway, Wnt signaling pathway, Hippo signaling pathway, Signaling pathways regulating pluripotency of stem cells, Melanogenesis, Cushing syndrome, Proteoglycans in cancer, Basal cell carcinoma, Breast cancer, Hepatocellular carcinoma, Gastric cancer, WNT ligand biogenesis and trafficking 1 shared evidence sourceGWAS catalog (Dupuytren contracture) Related via 12 shared pathways including mTOR signaling pathway, Wnt signaling pathway — evidence mostly GWAS catalog. WNT6 12 shared pathwaysmTOR signaling pathway, Wnt signaling pathway, Hippo signaling pathway, Signaling pathways regulating pluripotency of stem cells, Melanogenesis, Cushing syndrome, Proteoglycans in cancer, Basal cell carcinoma, Breast cancer, Hepatocellular carcinoma, Gastric cancer, WNT ligand biogenesis and trafficking Related via 12 shared pathways including mTOR signaling pathway, Wnt signaling pathway. WNT7A 12 shared pathwaysmTOR signaling pathway, Wnt signaling pathway, Hippo signaling pathway, Signaling pathways regulating pluripotency of stem cells, Melanogenesis, Cushing syndrome, Proteoglycans in cancer, Basal cell carcinoma, Breast cancer, Hepatocellular carcinoma, Gastric cancer, WNT ligand biogenesis and trafficking Related via 12 shared pathways including mTOR signaling pathway, Wnt signaling pathway. WNT10B 12 shared pathwaysmTOR signaling pathway, Wnt signaling pathway, Hippo signaling pathway, Signaling pathways regulating pluripotency of stem cells, Melanogenesis, Cushing syndrome, Proteoglycans in cancer, Basal cell carcinoma, Breast cancer, Hepatocellular carcinoma, Gastric cancer, WNT ligand biogenesis and trafficking Related via 12 shared pathways including mTOR signaling pathway, Wnt signaling pathway. WNT2B 12 shared pathwaysmTOR signaling pathway, Wnt signaling pathway, Hippo signaling pathway, Signaling pathways regulating pluripotency of stem cells, Melanogenesis, Cushing syndrome, Proteoglycans in cancer, Basal cell carcinoma, Breast cancer, Hepatocellular carcinoma, Gastric cancer, WNT ligand biogenesis and trafficking Related via 12 shared pathways including mTOR signaling pathway, Wnt signaling pathway.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
WNT7B	1	["Dupuytren contracture"]	12	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer","WNT ligand biogenesis and trafficking"]	1	["GWAS catalog (Dupuytren contracture)"]
WNT6	0	[]	12	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer","WNT ligand biogenesis and trafficking"]	0	[]
WNT7A	0	[]	12	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer","WNT ligand biogenesis and trafficking"]	0	[]
WNT10B	0	[]	12	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer","WNT ligand biogenesis and trafficking"]	0	[]
WNT2B	0	[]	12	["mTOR signaling pathway","Wnt signaling pathway","Hippo signaling pathway","Signaling pathways regulating pluripotency of stem cells","Melanogenesis","Cushing syndrome","Proteoglycans in cancer","Basal cell carcinoma","Breast cancer","Hepatocellular carcinoma","Gastric cancer","WNT ligand biogenesis and trafficking"]	0	[]

Diseases Linked via Similar Genes

Desbuquois syndrome Linked via 3 of 5 related genesWNT6, WNT7A, WNT10B Androgenetic alopecia Linked via 2 of 5 related genesWNT7B, WNT6 Major depressive disorder Linked via 2 of 5 related genesWNT7B, WNT2B Diabetes mellitus type 2 Linked via 2 of 5 related genesWNT7B, WNT6 Alzheimer disease Linked via 1 of 5 related genesWNT7B

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Desbuquois syndrome	3	["WNT6","WNT7A","WNT10B"]
Androgenetic alopecia	2	["WNT7B","WNT6"]
Major depressive disorder	2	["WNT7B","WNT2B"]
Diabetes mellitus type 2	2	["WNT7B","WNT6"]
Alzheimer disease	1	["WNT7B"]