VIP (vasoactive intestinal peptide)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7432
• Gene name: Vasoactive intestinal peptide
• Gene symbol: VIP
• Synonyms (NCBI Gene): PHM27
• Chromosome: 6
• Chromosome location: 6q25.2
• Summary: The protein encoded by this gene belongs to the glucagon family. It stimulates myocardial contractility, causes vasodilation, increases glycogenolysis, lowers arterial blood pressure and relaxes the smooth muscle of trachea, stomach and gall bladder. The

miRNA Show/Hide all (25)

miRTarBase ID	miRNA	Experiments	Reference
MIRT016951	hsa-miR-335-5p	Microarray	18185580
MIRT1484931	hsa-miR-181a	CLIP-seq
MIRT1484932	hsa-miR-181b	CLIP-seq
MIRT1484933	hsa-miR-181c	CLIP-seq
MIRT1484934	hsa-miR-181d	CLIP-seq
MIRT1484935	hsa-miR-2276	CLIP-seq
MIRT1484936	hsa-miR-338-5p	CLIP-seq
MIRT1484937	hsa-miR-3591-3p	CLIP-seq
MIRT1484938	hsa-miR-4262	CLIP-seq
MIRT1484939	hsa-miR-4686	CLIP-seq
MIRT1484940	hsa-miR-4772-3p	CLIP-seq
MIRT1484941	hsa-miR-513b	CLIP-seq
MIRT1484942	hsa-miR-548c-3p	CLIP-seq
MIRT1484943	hsa-miR-185	CLIP-seq
MIRT1484944	hsa-miR-3671	CLIP-seq
MIRT1484945	hsa-miR-371-5p	CLIP-seq
MIRT1484946	hsa-miR-371b-5p	CLIP-seq
MIRT1484947	hsa-miR-4306	CLIP-seq
MIRT1484948	hsa-miR-4433	CLIP-seq
MIRT1484949	hsa-miR-4459	CLIP-seq
MIRT1484950	hsa-miR-4644	CLIP-seq
MIRT1484951	hsa-miR-4680-5p	CLIP-seq
MIRT1484952	hsa-miR-4699-3p	CLIP-seq
MIRT1484953	hsa-miR-4768-3p	CLIP-seq
MIRT1484954	hsa-miR-9	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CREB1	Unknown	1847391
REST	Unknown	15009665
STAT1	Unknown	12425940

Gene ontology (GO) Show/Hide all (37)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001878	Process	Response to yeast	IDA	18603306
GO:0005179	Function	Hormone activity	IDA	9603988
GO:0005179	Function	Hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	IBA
GO:0005184	Function	Neuropeptide hormone activity	IDA	3456568, 36385145
GO:0005184	Function	Neuropeptide hormone activity	IEA
GO:0005184	Function	Neuropeptide hormone activity	TAS	10096039
GO:0005515	Function	Protein binding	IPI	21314817, 23597562, 25416956, 32296183
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IDA	8933357, 36385145
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS	10096039
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	8933357, 17110384
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IDA	8933357, 9603988, 36385145
GO:0007189	Process	Adenylate cyclase-activating G protein-coupled receptor signaling pathway	IEA
GO:0007589	Process	Body fluid secretion	TAS	4035357
GO:0008284	Process	Positive regulation of cell population proliferation	TAS	8389448
GO:0019731	Process	Antibacterial humoral response	IDA	18603306
GO:0019732	Process	Antifungal humoral response	IDA	18603306
GO:0031891	Function	Type 1 vasoactive intestinal polypeptide receptor binding	IDA	36385145
GO:0031892	Function	Type 2 vasoactive intestinal polypeptide receptor binding	IDA	8933357
GO:0032880	Process	Regulation of protein localization	IBA
GO:0032880	Process	Regulation of protein localization	IDA	9603988
GO:0032880	Process	Regulation of protein localization	IEA
GO:0043005	Component	Neuron projection	IBA
GO:0045087	Process	Innate immune response	IDA	18603306
GO:0045732	Process	Positive regulation of protein catabolic process	IDA	9603988
GO:0045732	Process	Positive regulation of protein catabolic process	IEA
GO:0048242	Process	Epinephrine secretion	IBA
GO:0048255	Process	MRNA stabilization	ISS
GO:0050829	Process	Defense response to Gram-negative bacterium	IDA	18603306
GO:0050830	Process	Defense response to Gram-positive bacterium	IDA	18603306
GO:0051428	Function	Peptide hormone receptor binding	IBA
GO:0051428	Function	Peptide hormone receptor binding	IPI	8390245
GO:0061844	Process	Antimicrobial humoral immune response mediated by antimicrobial peptide	IDA	18603306
GO:0070459	Process	Prolactin secretion	ISS
GO:0141163	Process	Positive regulation of cAMP/PKA signal transduction	IBA

Other IDs

• MIM: 192320
• HGNC: 12693
• e!Ensembl: ENSG00000146469

Protein

• UniProt ID: P01282
• Protein name: VIP peptides [Cleaved into: Intestinal peptide PHV-42 (Peptide histidine valine 42) (PHV-42); Intestinal peptide PHM-27 (Peptide histidine methioninamide 27) (PHM-27); Vasoactive intestinal peptide (VIP) (Vasoactive intestinal polypeptide)]
• Protein function: [Vasoactive intestinal peptide]: VIP is a neuropeptide involved in a diverse array of physiological processes through activating the PACAP subfamily of class B1 G protein-coupled receptors: VIP receptor 1 (VPR1) and VIP receptor 2 (VPR2) (PubMed
• PDB: 2RRH , 2RRI , 8E3Z
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00123	Hormone_2	81 → 108	Peptide hormone	Family
  PF00123	Hormone_2	125 → 152	Peptide hormone	Family

• Sequence:

  MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDM
  LQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRVSSNISEDPV
  PVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK

• Sequence length: 170

Pathways

KEGG Pathway	Reactome Pathway
cAMP signaling pathway	G alpha (s) signalling events
Neuroactive ligand-receptor interaction	Glucagon-type ligand receptors
Hormone signaling	ADORA2B mediated anti-inflammatory cytokines production

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (19)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ASPERGER SYNDROME	—	Orphanet	23849776	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISTIC DISORDER	—	CTD, Disgenet CTD, Disgenet	17521630	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRONCHIAL HYPERREACTIVITY	—	CTD, Disgenet CTD, Disgenet	15127121, 15144609	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COGNITION DISORDERS	—	CTD	8208360	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DELIRIUM, DEMENTIA, AMNESTIC, COGNITIVE DISORDERS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DOWN SYNDROME	—	CTD, Disgenet CTD, Disgenet	16289943	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EDEMA	—	CTD	7508328	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ERECTILE DYSFUNCTION	—	CTD, Disgenet CTD, Disgenet	10233493	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERALGESIA	—	CTD	12787826	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTENSION	—	CTD	9881641	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTELLECTUAL DISABILITY	—	CTD	11357950	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL RETARDATION	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	19189304	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHINITIS	—	CTD, Disgenet CTD, Disgenet	12746121, 14680090	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SARCOIDOSIS, PULMONARY	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER DISEASES	—	CTD, Disgenet CTD, Disgenet	18299998	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	40050615	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CALCA 4 shared diseasesBronchial hyperreactivity, Down syndrome, Edema, Hyperalgesia 3 shared pathwaysHormone signaling, G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production 7 shared evidence sourcesCTD (Bronchial hyperreactivity), Disgenet (Bronchial hyperreactivity), Disgenet (Down syndrome), CTD (Down syndrome), CTD (Edema), CTD (Hyperalgesia), CTD (Intellectual developmental disorder) Related via 4 shared diseases including Bronchial hyperreactivity, Down syndrome — evidence mostly CTD. GIPR 5 shared pathwayscAMP signaling pathway, Hormone signaling, G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production, Glucagon-type ligand receptors Related via 5 shared pathways including cAMP signaling pathway, Hormone signaling. VIPR2 5 shared pathwayscAMP signaling pathway, Hormone signaling, G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production, Glucagon-type ligand receptors Related via 5 shared pathways including cAMP signaling pathway, Hormone signaling. VIPR1 4 shared pathwaysHormone signaling, G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production, Glucagon-type ligand receptors Related via 4 shared pathways including Hormone signaling, G alpha (s) signalling events. CRH 3 shared diseasesCognition disorder, Delirium, dementia, and cognitive disorders, Hypotension 4 shared pathwayscAMP signaling pathway, Hormone signaling, G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production 3 shared evidence sourcesCTD (Cognition disorder), Disgenet (Delirium, dementia, and cognitive disorders), CTD (Hypotension) Related via 4 shared pathways including cAMP signaling pathway, Hormone signaling — evidence mostly CTD.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CALCA	4	["Bronchial hyperreactivity","Down syndrome","Edema","Hyperalgesia"]	3	["Hormone signaling","G alpha (s) signalling events","ADORA2B mediated anti-inflammatory cytokines production"]	7	["CTD (Bronchial hyperreactivity)","Disgenet (Bronchial hyperreactivity)","Disgenet (Down syndrome)","CTD (Down syndrome)","CTD (Edema)","CTD (Hyperalgesia)","CTD (Intellectual developmental disorder)"]
GIPR	0	[]	5	["cAMP signaling pathway","Hormone signaling","G alpha (s) signalling events","ADORA2B mediated anti-inflammatory cytokines production","Glucagon-type ligand receptors"]	0	[]
VIPR2	0	[]	5	["cAMP signaling pathway","Hormone signaling","G alpha (s) signalling events","ADORA2B mediated anti-inflammatory cytokines production","Glucagon-type ligand receptors"]	0	[]
VIPR1	0	[]	4	["Hormone signaling","G alpha (s) signalling events","ADORA2B mediated anti-inflammatory cytokines production","Glucagon-type ligand receptors"]	0	[]
CRH	3	["Cognition disorder","Delirium, dementia, and cognitive disorders","Hypotension"]	4	["cAMP signaling pathway","Hormone signaling","G alpha (s) signalling events","ADORA2B mediated anti-inflammatory cytokines production"]	3	["CTD (Cognition disorder)","Disgenet (Delirium, dementia, and cognitive disorders)","CTD (Hypotension)"]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 3 of 5 related genesGIPR, VIPR2, CRH Obesity Linked via 3 of 5 related genesGIPR, VIPR1, CRH Depression Linked via 2 of 5 related genesCALCA, CRH Osteoarthritis Linked via 2 of 5 related genesCALCA, GIPR Metabolic syndrome Linked via 2 of 5 related genesGIPR, VIPR1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	3	["GIPR","VIPR2","CRH"]
Obesity	3	["GIPR","VIPR1","CRH"]
Depression	2	["CALCA","CRH"]
Osteoarthritis	2	["CALCA","GIPR"]
Metabolic syndrome	2	["GIPR","VIPR1"]