VAV2 (vav guanine nucleotide exchange factor 2)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7410
• Gene name: Vav guanine nucleotide exchange factor 2
• Gene symbol: VAV2
• Synonyms (NCBI Gene): VAV-2
• Chromosome: 9
• Chromosome location: 9q34.2
• Summary: VAV2 is the second member of the VAV guanine nucleotide exchange factor family of oncogenes. Unlike VAV1, which is expressed exclusively in hematopoietic cells, VAV2 transcripts were found in most tissues. Alternatively spliced transcript variants encodin

miRNA Show/Hide all (322)

miRTarBase ID	miRNA	Experiments	Reference
MIRT020809	hsa-miR-155-5p	Proteomics	18668040
MIRT052458	hsa-let-7a-5p	CLASH	23622248
MIRT044622	hsa-miR-320a	CLASH	23622248
MIRT041420	hsa-miR-193b-3p	CLASH	23622248
MIRT036995	hsa-miR-877-3p	CLASH	23622248
MIRT053479	hsa-miR-148a-3p	Luciferase reporter assay, Microarray, qRT-PCR	21703006
MIRT565046	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT565045	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT565044	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT565043	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT565042	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT565041	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT565040	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT565039	hsa-miR-4524b-3p	PAR-CLIP	20371350
MIRT565038	hsa-miR-6165	PAR-CLIP	20371350
MIRT565037	hsa-miR-214-3p	PAR-CLIP	20371350
MIRT565036	hsa-miR-3619-5p	PAR-CLIP	20371350
MIRT565035	hsa-miR-761	PAR-CLIP	20371350
MIRT565034	hsa-miR-331-3p	PAR-CLIP	20371350
MIRT565033	hsa-miR-4292	PAR-CLIP	20371350
MIRT565032	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT565031	hsa-miR-3192-5p	PAR-CLIP	20371350
MIRT565030	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT565029	hsa-miR-6124	PAR-CLIP	20371350
MIRT565027	hsa-miR-6081	PAR-CLIP	20371350
MIRT565028	hsa-miR-6827-5p	PAR-CLIP	20371350
MIRT565026	hsa-miR-6090	PAR-CLIP	20371350
MIRT565025	hsa-miR-4300	PAR-CLIP	20371350
MIRT565024	hsa-miR-5591-5p	PAR-CLIP	20371350
MIRT565023	hsa-miR-6726-5p	PAR-CLIP	20371350
MIRT565022	hsa-miR-920	PAR-CLIP	20371350
MIRT439310	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439310	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT565046	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT565045	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT565044	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT565043	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT565042	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT565041	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT565040	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT565039	hsa-miR-4524b-3p	PAR-CLIP	20371350
MIRT565038	hsa-miR-6165	PAR-CLIP	20371350
MIRT565037	hsa-miR-214-3p	PAR-CLIP	20371350
MIRT565036	hsa-miR-3619-5p	PAR-CLIP	20371350
MIRT565035	hsa-miR-761	PAR-CLIP	20371350
MIRT565034	hsa-miR-331-3p	PAR-CLIP	20371350
MIRT565033	hsa-miR-4292	PAR-CLIP	20371350
MIRT565032	hsa-miR-6791-5p	PAR-CLIP	20371350
MIRT565031	hsa-miR-3192-5p	PAR-CLIP	20371350
MIRT565030	hsa-miR-873-5p	PAR-CLIP	20371350
MIRT565029	hsa-miR-6124	PAR-CLIP	20371350
MIRT565027	hsa-miR-6081	PAR-CLIP	20371350
MIRT565028	hsa-miR-6827-5p	PAR-CLIP	20371350
MIRT565026	hsa-miR-6090	PAR-CLIP	20371350
MIRT565025	hsa-miR-4300	PAR-CLIP	20371350
MIRT565024	hsa-miR-5591-5p	PAR-CLIP	20371350
MIRT565023	hsa-miR-6726-5p	PAR-CLIP	20371350
MIRT565022	hsa-miR-920	PAR-CLIP	20371350
MIRT1482990	hsa-miR-1182	CLIP-seq
MIRT1482991	hsa-miR-1208	CLIP-seq
MIRT1482992	hsa-miR-1272	CLIP-seq
MIRT1482993	hsa-miR-1275	CLIP-seq
MIRT1482994	hsa-miR-149	CLIP-seq
MIRT739287	hsa-miR-1976	CLIP-seq
MIRT1482995	hsa-miR-216b	CLIP-seq
MIRT1482996	hsa-miR-28-5p	CLIP-seq
MIRT1482997	hsa-miR-3064-5p	CLIP-seq
MIRT1482998	hsa-miR-3123	CLIP-seq
MIRT1482999	hsa-miR-3126-3p	CLIP-seq
MIRT1483000	hsa-miR-3127-5p	CLIP-seq
MIRT1483001	hsa-miR-3128	CLIP-seq
MIRT1483002	hsa-miR-3132	CLIP-seq
MIRT1483003	hsa-miR-3133	CLIP-seq
MIRT1483004	hsa-miR-3139	CLIP-seq
MIRT1483005	hsa-miR-3163	CLIP-seq
MIRT1483006	hsa-miR-3192	CLIP-seq
MIRT1483007	hsa-miR-335	CLIP-seq
MIRT1483008	hsa-miR-340	CLIP-seq
MIRT1483009	hsa-miR-3652	CLIP-seq
MIRT1483010	hsa-miR-3689a-3p	CLIP-seq
MIRT1483011	hsa-miR-3689c	CLIP-seq
MIRT739286	hsa-miR-370	CLIP-seq
MIRT1483012	hsa-miR-3925-5p	CLIP-seq
MIRT1483013	hsa-miR-3929	CLIP-seq
MIRT1483014	hsa-miR-4264	CLIP-seq
MIRT1483015	hsa-miR-4302	CLIP-seq
MIRT1483016	hsa-miR-433	CLIP-seq
MIRT1483017	hsa-miR-4419a	CLIP-seq
MIRT1483018	hsa-miR-4419b	CLIP-seq
MIRT1483019	hsa-miR-4430	CLIP-seq
MIRT1483020	hsa-miR-4433	CLIP-seq
MIRT1483021	hsa-miR-4451	CLIP-seq
MIRT1483022	hsa-miR-4474-3p	CLIP-seq
MIRT1483023	hsa-miR-4478	CLIP-seq
MIRT1483024	hsa-miR-4487	CLIP-seq
MIRT1483025	hsa-miR-4505	CLIP-seq
MIRT1483026	hsa-miR-4506	CLIP-seq
MIRT1483027	hsa-miR-450b-5p	CLIP-seq
MIRT1483028	hsa-miR-4510	CLIP-seq
MIRT1483029	hsa-miR-4511	CLIP-seq
MIRT1483030	hsa-miR-4525	CLIP-seq
MIRT1483031	hsa-miR-4641	CLIP-seq
MIRT1483032	hsa-miR-4665-5p	CLIP-seq
MIRT1483033	hsa-miR-4668-3p	CLIP-seq
MIRT1483034	hsa-miR-4708-3p	CLIP-seq
MIRT1483035	hsa-miR-4720-5p	CLIP-seq
MIRT1483036	hsa-miR-4723-5p	CLIP-seq
MIRT1483037	hsa-miR-4728-5p	CLIP-seq
MIRT1483038	hsa-miR-4731-5p	CLIP-seq
MIRT1483039	hsa-miR-4732-5p	CLIP-seq
MIRT1483040	hsa-miR-4742-5p	CLIP-seq
MIRT1483041	hsa-miR-4794	CLIP-seq
MIRT1483042	hsa-miR-4797-3p	CLIP-seq
MIRT1483043	hsa-miR-4799-3p	CLIP-seq
MIRT1483044	hsa-miR-510	CLIP-seq
MIRT1483045	hsa-miR-520d-5p	CLIP-seq
MIRT1483046	hsa-miR-524-5p	CLIP-seq
MIRT739284	hsa-miR-548aa	CLIP-seq
MIRT739285	hsa-miR-570	CLIP-seq
MIRT1483047	hsa-miR-578	CLIP-seq
MIRT1483048	hsa-miR-625	CLIP-seq
MIRT1483049	hsa-miR-637	CLIP-seq
MIRT1483050	hsa-miR-665	CLIP-seq
MIRT1483051	hsa-miR-670	CLIP-seq
MIRT1483052	hsa-miR-708	CLIP-seq
MIRT1483053	hsa-miR-885-3p	CLIP-seq
MIRT1482991	hsa-miR-1208	CLIP-seq
MIRT1482993	hsa-miR-1275	CLIP-seq
MIRT1483054	hsa-miR-1915	CLIP-seq
MIRT739287	hsa-miR-1976	CLIP-seq
MIRT1482996	hsa-miR-28-5p	CLIP-seq
MIRT1483055	hsa-miR-296-5p	CLIP-seq
MIRT1483056	hsa-miR-30a	CLIP-seq
MIRT1483057	hsa-miR-30b	CLIP-seq
MIRT1483058	hsa-miR-30c	CLIP-seq
MIRT1483059	hsa-miR-30d	CLIP-seq
MIRT1483060	hsa-miR-30e	CLIP-seq
MIRT1483002	hsa-miR-3132	CLIP-seq
MIRT1483004	hsa-miR-3139	CLIP-seq
MIRT1483061	hsa-miR-3183	CLIP-seq
MIRT1483006	hsa-miR-3192	CLIP-seq
MIRT1483009	hsa-miR-3652	CLIP-seq
MIRT1483010	hsa-miR-3689a-3p	CLIP-seq
MIRT1483011	hsa-miR-3689c	CLIP-seq
MIRT739286	hsa-miR-370	CLIP-seq
MIRT1483062	hsa-miR-3907	CLIP-seq
MIRT1483063	hsa-miR-4256	CLIP-seq
MIRT1483064	hsa-miR-4258	CLIP-seq
MIRT1483017	hsa-miR-4419a	CLIP-seq
MIRT1483019	hsa-miR-4430	CLIP-seq
MIRT1483021	hsa-miR-4451	CLIP-seq
MIRT1483065	hsa-miR-4462	CLIP-seq
MIRT1483022	hsa-miR-4474-3p	CLIP-seq
MIRT1483024	hsa-miR-4487	CLIP-seq
MIRT1483025	hsa-miR-4505	CLIP-seq
MIRT1483026	hsa-miR-4506	CLIP-seq
MIRT1483028	hsa-miR-4510	CLIP-seq
MIRT1483030	hsa-miR-4525	CLIP-seq
MIRT1483066	hsa-miR-4645-3p	CLIP-seq
MIRT1483032	hsa-miR-4665-5p	CLIP-seq
MIRT1483067	hsa-miR-4691-5p	CLIP-seq
MIRT1483068	hsa-miR-4723-3p	CLIP-seq
MIRT1483036	hsa-miR-4723-5p	CLIP-seq
MIRT1483037	hsa-miR-4728-5p	CLIP-seq
MIRT1483069	hsa-miR-4731-3p	CLIP-seq
MIRT1483038	hsa-miR-4731-5p	CLIP-seq
MIRT1483039	hsa-miR-4732-5p	CLIP-seq
MIRT1483070	hsa-miR-4749-3p	CLIP-seq
MIRT1483071	hsa-miR-4762-3p	CLIP-seq
MIRT1483072	hsa-miR-4801	CLIP-seq
MIRT1483073	hsa-miR-516a-3p	CLIP-seq
MIRT739284	hsa-miR-548aa	CLIP-seq
MIRT739285	hsa-miR-570	CLIP-seq
MIRT1483048	hsa-miR-625	CLIP-seq
MIRT1483049	hsa-miR-637	CLIP-seq
MIRT1483052	hsa-miR-708	CLIP-seq
MIRT739287	hsa-miR-1976	CLIP-seq
MIRT739286	hsa-miR-370	CLIP-seq
MIRT739284	hsa-miR-548aa	CLIP-seq
MIRT739285	hsa-miR-570	CLIP-seq
MIRT739287	hsa-miR-1976	CLIP-seq
MIRT739286	hsa-miR-370	CLIP-seq
MIRT739284	hsa-miR-548aa	CLIP-seq
MIRT739285	hsa-miR-570	CLIP-seq
MIRT739287	hsa-miR-1976	CLIP-seq
MIRT739286	hsa-miR-370	CLIP-seq
MIRT739284	hsa-miR-548aa	CLIP-seq
MIRT739285	hsa-miR-570	CLIP-seq
MIRT2145408	hsa-miR-1247	CLIP-seq
MIRT1482992	hsa-miR-1272	CLIP-seq
MIRT1482993	hsa-miR-1275	CLIP-seq
MIRT2145409	hsa-miR-15a	CLIP-seq
MIRT2145410	hsa-miR-15b	CLIP-seq
MIRT2145411	hsa-miR-16	CLIP-seq
MIRT1483054	hsa-miR-1915	CLIP-seq
MIRT2145412	hsa-miR-195	CLIP-seq
MIRT739287	hsa-miR-1976	CLIP-seq
MIRT2145413	hsa-miR-214	CLIP-seq
MIRT2145414	hsa-miR-2467-3p	CLIP-seq
MIRT1483006	hsa-miR-3192	CLIP-seq
MIRT2145415	hsa-miR-346	CLIP-seq
MIRT2145416	hsa-miR-3657	CLIP-seq
MIRT2145417	hsa-miR-3660	CLIP-seq
MIRT2145418	hsa-miR-3663-5p	CLIP-seq
MIRT739286	hsa-miR-370	CLIP-seq
MIRT1483013	hsa-miR-3929	CLIP-seq
MIRT2145419	hsa-miR-424	CLIP-seq
MIRT1483064	hsa-miR-4258	CLIP-seq
MIRT1483014	hsa-miR-4264	CLIP-seq
MIRT2145420	hsa-miR-4281	CLIP-seq
MIRT1483015	hsa-miR-4302	CLIP-seq
MIRT1483016	hsa-miR-433	CLIP-seq
MIRT1483018	hsa-miR-4419b	CLIP-seq
MIRT2145421	hsa-miR-4455	CLIP-seq
MIRT1483023	hsa-miR-4478	CLIP-seq
MIRT2145422	hsa-miR-4512	CLIP-seq
MIRT1483030	hsa-miR-4525	CLIP-seq
MIRT2145423	hsa-miR-4526	CLIP-seq
MIRT1483032	hsa-miR-4665-5p	CLIP-seq
MIRT2145424	hsa-miR-4669	CLIP-seq
MIRT2145425	hsa-miR-4690-3p	CLIP-seq
MIRT1483034	hsa-miR-4708-3p	CLIP-seq
MIRT1483036	hsa-miR-4723-5p	CLIP-seq
MIRT2145426	hsa-miR-4726-3p	CLIP-seq
MIRT1483038	hsa-miR-4731-5p	CLIP-seq
MIRT2145427	hsa-miR-4740-3p	CLIP-seq
MIRT1483040	hsa-miR-4742-5p	CLIP-seq
MIRT2145428	hsa-miR-4795-3p	CLIP-seq
MIRT1483042	hsa-miR-4797-3p	CLIP-seq
MIRT2145429	hsa-miR-4799-5p	CLIP-seq
MIRT2145430	hsa-miR-497	CLIP-seq
MIRT2145431	hsa-miR-508-5p	CLIP-seq
MIRT739284	hsa-miR-548aa	CLIP-seq
MIRT739285	hsa-miR-570	CLIP-seq
MIRT2145432	hsa-miR-592	CLIP-seq
MIRT2145433	hsa-miR-599	CLIP-seq
MIRT1483048	hsa-miR-625	CLIP-seq
MIRT2145434	hsa-miR-944	CLIP-seq
MIRT2365630	hsa-miR-130a	CLIP-seq
MIRT2365631	hsa-miR-130b	CLIP-seq
MIRT2365632	hsa-miR-182	CLIP-seq
MIRT2365633	hsa-miR-301a	CLIP-seq
MIRT2365634	hsa-miR-301b	CLIP-seq
MIRT2365635	hsa-miR-3666	CLIP-seq
MIRT2365636	hsa-miR-4295	CLIP-seq
MIRT2365637	hsa-miR-454	CLIP-seq
MIRT2145428	hsa-miR-4795-3p	CLIP-seq
MIRT1482993	hsa-miR-1275	CLIP-seq
MIRT2365638	hsa-miR-1470	CLIP-seq
MIRT1482994	hsa-miR-149	CLIP-seq
MIRT2365639	hsa-miR-188-3p	CLIP-seq
MIRT739287	hsa-miR-1976	CLIP-seq
MIRT2145413	hsa-miR-214	CLIP-seq
MIRT2145414	hsa-miR-2467-3p	CLIP-seq
MIRT1482996	hsa-miR-28-5p	CLIP-seq
MIRT2365640	hsa-miR-2964a-5p	CLIP-seq
MIRT1482997	hsa-miR-3064-5p	CLIP-seq
MIRT1483004	hsa-miR-3139	CLIP-seq
MIRT2365641	hsa-miR-3151	CLIP-seq
MIRT1483009	hsa-miR-3652	CLIP-seq
MIRT739286	hsa-miR-370	CLIP-seq
MIRT2365642	hsa-miR-3921	CLIP-seq
MIRT1483014	hsa-miR-4264	CLIP-seq
MIRT1483015	hsa-miR-4302	CLIP-seq
MIRT1483019	hsa-miR-4430	CLIP-seq
MIRT1483020	hsa-miR-4433	CLIP-seq
MIRT2365643	hsa-miR-4447	CLIP-seq
MIRT2145421	hsa-miR-4455	CLIP-seq
MIRT2365644	hsa-miR-4468	CLIP-seq
MIRT2365645	hsa-miR-4472	CLIP-seq
MIRT1483022	hsa-miR-4474-3p	CLIP-seq
MIRT2365646	hsa-miR-4488	CLIP-seq
MIRT1483025	hsa-miR-4505	CLIP-seq
MIRT1483030	hsa-miR-4525	CLIP-seq
MIRT2365647	hsa-miR-4633-3p	CLIP-seq
MIRT2365648	hsa-miR-4653-5p	CLIP-seq
MIRT2365649	hsa-miR-4656	CLIP-seq
MIRT2365650	hsa-miR-4663	CLIP-seq
MIRT1483032	hsa-miR-4665-5p	CLIP-seq
MIRT2365651	hsa-miR-4682	CLIP-seq
MIRT2365652	hsa-miR-4685-5p	CLIP-seq
MIRT2365653	hsa-miR-4686	CLIP-seq
MIRT2365654	hsa-miR-4697-5p	CLIP-seq
MIRT1483036	hsa-miR-4723-5p	CLIP-seq
MIRT1483038	hsa-miR-4731-5p	CLIP-seq
MIRT2365655	hsa-miR-4736	CLIP-seq
MIRT1483041	hsa-miR-4794	CLIP-seq
MIRT1483042	hsa-miR-4797-3p	CLIP-seq
MIRT2365656	hsa-miR-486-3p	CLIP-seq
MIRT2365657	hsa-miR-491-5p	CLIP-seq
MIRT2365658	hsa-miR-532-3p	CLIP-seq
MIRT739284	hsa-miR-548aa	CLIP-seq
MIRT739285	hsa-miR-570	CLIP-seq
MIRT1483048	hsa-miR-625	CLIP-seq
MIRT1483049	hsa-miR-637	CLIP-seq
MIRT2365659	hsa-miR-645	CLIP-seq
MIRT1483050	hsa-miR-665	CLIP-seq
MIRT1483052	hsa-miR-708	CLIP-seq
MIRT2145434	hsa-miR-944	CLIP-seq
MIRT2365632	hsa-miR-182	CLIP-seq
MIRT739287	hsa-miR-1976	CLIP-seq
MIRT2145416	hsa-miR-3657	CLIP-seq
MIRT739286	hsa-miR-370	CLIP-seq
MIRT2396805	hsa-miR-4470	CLIP-seq
MIRT2145424	hsa-miR-4669	CLIP-seq
MIRT1483038	hsa-miR-4731-5p	CLIP-seq
MIRT739284	hsa-miR-548aa	CLIP-seq
MIRT739285	hsa-miR-570	CLIP-seq
MIRT2396806	hsa-miR-582-5p	CLIP-seq
MIRT2145432	hsa-miR-592	CLIP-seq
MIRT2145433	hsa-miR-599	CLIP-seq
MIRT739287	hsa-miR-1976	CLIP-seq
MIRT739286	hsa-miR-370	CLIP-seq
MIRT739284	hsa-miR-548aa	CLIP-seq
MIRT739285	hsa-miR-570	CLIP-seq
MIRT2694955	hsa-miR-1236	CLIP-seq
MIRT739287	hsa-miR-1976	CLIP-seq
MIRT2694956	hsa-miR-3162-3p	CLIP-seq
MIRT739286	hsa-miR-370	CLIP-seq
MIRT1483064	hsa-miR-4258	CLIP-seq
MIRT739284	hsa-miR-548aa	CLIP-seq
MIRT739285	hsa-miR-570	CLIP-seq

Gene ontology (GO) Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001525	Process	Angiogenesis	IEA
GO:0001784	Function	Phosphotyrosine residue binding	IPI	20624904
GO:0002768	Process	Immune response-regulating cell surface receptor signaling pathway	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	EXP	8990121
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IBA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	IEA
GO:0005085	Function	Guanyl-nucleotide exchange factor activity	TAS
GO:0005154	Function	Epidermal growth factor receptor binding	IEA
GO:0005515	Function	Protein binding	IPI	11390470, 15345594, 15618286, 16273093, 18654987, 20598684, 20808760, 24728074, 26919541
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	IEA
GO:0007165	Process	Signal transduction	TAS	7762982
GO:0007264	Process	Small GTPase-mediated signal transduction	IBA
GO:0007264	Process	Small GTPase-mediated signal transduction	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008361	Process	Regulation of cell size	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0016477	Process	Cell migration	IBA
GO:0016477	Process	Cell migration	IEA
GO:0030031	Process	Cell projection assembly	IEA
GO:0030032	Process	Lamellipodium assembly	IEA
GO:0030168	Process	Platelet activation	IEA
GO:0030168	Process	Platelet activation	TAS
GO:0035556	Process	Intracellular signal transduction	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	IEA
GO:0038095	Process	Fc-epsilon receptor signaling pathway	TAS
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	IEA
GO:0038096	Process	Fc-gamma receptor signaling pathway involved in phagocytosis	TAS
GO:0046872	Function	Metal ion binding	IEA
GO:0048010	Process	Vascular endothelial growth factor receptor signaling pathway	TAS
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	IEA
GO:0051056	Process	Regulation of small GTPase mediated signal transduction	TAS
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0051897	Process	Positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IEA
GO:0071466	Process	Cellular response to xenobiotic stimulus	TAS

Other IDs

• MIM: 600428
• HGNC: 12658
• e!Ensembl: ENSG00000160293

Protein

• UniProt ID: P52735
• Protein name: Guanine nucleotide exchange factor VAV2 (VAV-2)
• Protein function: Guanine nucleotide exchange factor for the Rho family of Ras-related GTPases. Plays an important role in angiogenesis. Its recruitment by phosphorylated EPHA2 is critical for EFNA1-induced RAC1 GTPase activation and vascular endothelial cell mig
• PDB: 2DLZ , 2DM1 , 2LNW , 2LNX , 4ROJ , 7RNV , 7WFY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00017	SH2	673 → 747	SH2 domain	Domain
  PF00130	C1_1	524 → 574	Phorbol esters/diacylglycerol binding domain (C1 domain)	Domain
  PF00169	PH	406 → 512	PH domain	Domain
  PF00307	CH	1 → 121	Calponin homology (CH) domain	Domain
  PF00621	RhoGEF	202 → 374	RhoGEF domain	Domain
  PF07653	SH3_2	820 → 875	Variant SH3 domain	Domain
  PF07653	SH3_2	590 → 650	Variant SH3 domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Widely expressed.
• Sequence:

  MEQWRQCGRWLIDCKVLPPNHRVVWPSAVVFDLAQALRDGVLLCQLLHNLSPGSIDLKDI
  NFRPQMSQFLCLKNIRTFLKVCHDKFGLRNSELFDPFDLFDVRDFGKVISAVSRLSLHSI
  AQNKGIRPFPSEETTENDDDVYRSLEELADEHDLGEDIYDCVPCEDGGDDIYEDIIKVEV
  QQPMIRYMQKMGMTEDDKRNCCLLEIQETEAKYYRTLEDIEKNYMSPLRLVLSPADMAAV
  FINLEDLIKVHHSFLRAIDVSVMVGGSTLAKVFLDFKERLLIYGEYCSHMEHAQNTLNQL
  LASREDFRQKVEECTLKVQDGKFKLQDLLVVPMQRVLKYHLLLKELLSHSAERPERQQLK
  EALEAMQDLAMYINEVKRDKETLRKISEFQSSIENLQVKLEEFGRPKIDGELKVRSIVNH
  TKQDRYLFLFDKVVIVCKRKGYSYELKEIIELLFHKMTDDPMNNKDVKKSHGKMWSYGFY
  LIHLQGKQGFQFFCKTEDMKRKWMEQFEMAMSNIKPDKANANHHSFQMYTFDKTTNCKAC
  KMFLRGTFYQGYMCTKCGVGAHKECLEVIPPCKFTSPADLDASGAGPGPKMVAMQNYHGN
  PAPPGKPVLTFQTGDVLELLRGDPESPWWEGRLVQTRKSGYFPSSSVKPCPVDGRPPISR
  PPSREIDYTAYPWFAGNMERQQTDNLLKSHASGTYLIRERPAEAERFAISIKFNDEVKHI
  KVVEKDNWIHITEAKKFDSLLELVEYYQCHSLKESFKQLDTTLKYPYKSRERSASRASSR
  SPASCASYNFSFLSPQGLSFASQGPSAPFWSVFTPRVIGTAVARYNFAARDMRELSLREG
  DVVRIYSRIGGDQGWWKGETNGRIGWFPSTYVEEEGIQ

• Sequence length: 878

Pathways

KEGG Pathway	Reactome Pathway
Rap1 signaling pathway	GPVI-mediated activation cascade
cAMP signaling pathway	NRAGE signals death through JNK
Chemokine signaling pathway	Rho GTPase cycle
Focal adhesion	Regulation of actin dynamics for phagocytic cup formation
Natural killer cell mediated cytotoxicity	DAP12 signaling
T cell receptor signaling pathway	FCERI mediated MAPK activation
B cell receptor signaling pathway	FCERI mediated Ca+2 mobilization
Fc epsilon RI signaling pathway	EPH-ephrin mediated repulsion of cells
Fc gamma R-mediated phagocytosis	G alpha (12/13) signalling events
Leukocyte transendothelial migration	VEGFA-VEGFR2 Pathway
Regulation of actin cytoskeleton	Signal transduction by L1
Yersinia infection	VEGFR2 mediated vascular permeability
Proteoglycans in cancer	FCGR3A-mediated phagocytosis
Lipid and atherosclerosis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (14)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	40708016	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	36539618	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL ASTIGMATISM	—	GWAS catalog	30306274	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	40708016	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	20598377	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	37033223	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OPEN-ANGLE GLAUCOMA	—	GWAS catalog	37386247, 39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	34993496	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	32541925, 37033223	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (45)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	28911143	Associate	★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	28911143		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	28270555, 28911143		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	28270555, 28911143		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31570505		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	35606283	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	16186116		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31570505		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	23033535, 23033540, 26910843, 28235899, 30087437, 30416862		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	18246042, 18829495, 28356423	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	39527598	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24858039		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	28157227	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28157227	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	31300985		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	20140222		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	20463313		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36426134	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Glomerulosclerosis (disorder)	Glomerulosclerosis	BEFREE	28193546		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	28193546		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	24699462, 28157227	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24699462		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	34894858	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	28459214	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	23033535, 23033540, 26910843, 28235899, 30087437, 30416862		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24858039		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28459214		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16397238	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	20598377		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	20598377		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	20598377		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Narcolepsy	Narcolepsy	GWASDB_DG	19629137		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	25277193	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	27986811, 28235899, 28459214		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	30955235		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28157227, 28479334	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	28157227		★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	27986811		★☆☆☆☆ Found in Text Mining only
Regular astigmatism - corneal	Corneal astigmatism	GWASCAT_DG	30306274		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17234718		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28459214		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	28459214, 36631800	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	27986811	Associate	★☆☆☆☆ Found in Text Mining only
Total anomalous pulmonary venous return	Pulmonary Venous Return Anomaly	BEFREE	30448225		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	27902969, 32495883	Associate	★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

ADAMTS8 2 shared diseasesCorneal astigmatism, Glaucoma 2 shared evidence sourcesGWAS catalog (Corneal astigmatism), GWAS catalog (Glaucoma) Related via 2 shared diseases including Corneal astigmatism, Glaucoma — evidence mostly GWAS catalog. LMO7 2 shared diseasesCorneal astigmatism, Glaucoma 2 shared evidence sourcesGWAS catalog (Corneal astigmatism), GWAS catalog (Glaucoma) Related via 2 shared diseases including Corneal astigmatism, Glaucoma — evidence mostly GWAS catalog. FMNL2 2 shared diseasesCorneal astigmatism, Glaucoma 2 shared evidence sourcesGWAS catalog (Corneal astigmatism), GWAS catalog (Glaucoma) Related via 2 shared diseases including Corneal astigmatism, Glaucoma — evidence mostly GWAS catalog. VAV3 26 shared pathwaysRap1 signaling pathway, cAMP signaling pathway, Chemokine signaling pathway, Focal adhesion, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Yersinia infection +14 more Related via 26 shared pathways including Rap1 signaling pathway, cAMP signaling pathway. VAV1 24 shared pathwaysRap1 signaling pathway, cAMP signaling pathway, Chemokine signaling pathway, Focal adhesion, Natural killer cell mediated cytotoxicity, T cell receptor signaling pathway, B cell receptor signaling pathway, Fc epsilon RI signaling pathway, Fc gamma R-mediated phagocytosis, Leukocyte transendothelial migration, Regulation of actin cytoskeleton, Yersinia infection +12 more Related via 24 shared pathways including Rap1 signaling pathway, cAMP signaling pathway.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
ADAMTS8	2	["Corneal astigmatism","Glaucoma"]	0	[]	2	["GWAS catalog (Corneal astigmatism)","GWAS catalog (Glaucoma)"]
LMO7	2	["Corneal astigmatism","Glaucoma"]	0	[]	2	["GWAS catalog (Corneal astigmatism)","GWAS catalog (Glaucoma)"]
FMNL2	2	["Corneal astigmatism","Glaucoma"]	0	[]	2	["GWAS catalog (Corneal astigmatism)","GWAS catalog (Glaucoma)"]
VAV3	0	[]	26	["Rap1 signaling pathway","cAMP signaling pathway","Chemokine signaling pathway","Focal adhesion","Natural killer cell mediated cytotoxicity","T cell receptor signaling pathway","B cell receptor signaling pathway","Fc epsilon RI signaling pathway","Fc gamma R-mediated phagocytosis","Leukocyte transendothelial migration","Regulation of actin cytoskeleton","Yersinia infection"]	0	[]
VAV1	0	[]	24	["Rap1 signaling pathway","cAMP signaling pathway","Chemokine signaling pathway","Focal adhesion","Natural killer cell mediated cytotoxicity","T cell receptor signaling pathway","B cell receptor signaling pathway","Fc epsilon RI signaling pathway","Fc gamma R-mediated phagocytosis","Leukocyte transendothelial migration","Regulation of actin cytoskeleton","Yersinia infection"]	0	[]

Diseases Linked via Similar Genes

Hypertension Linked via 2 of 5 related genesADAMTS8, VAV3 Prostatic neoplasms Linked via 2 of 5 related genesADAMTS8, VAV3 Astrocytoma Linked via 2 of 5 related genesLMO7, FMNL2 Hearing loss Linked via 2 of 5 related genesLMO7, VAV1 Asthma Linked via 2 of 5 related genesFMNL2, VAV3

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Hypertension	2	["ADAMTS8","VAV3"]
Prostatic neoplasms	2	["ADAMTS8","VAV3"]
Astrocytoma	2	["LMO7","FMNL2"]
Hearing loss	2	["LMO7","VAV1"]
Asthma	2	["FMNL2","VAV3"]