UTP18 (UTP18 small subunit processome component)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 51096
• Gene name: UTP18 small subunit processome component
• Gene symbol: UTP18
• Synonyms (NCBI Gene): CGI-48, WDR50
• Chromosome: 17
• Chromosome location: 17q21.33

miRNA Show/Hide all (59)

miRTarBase ID	miRNA	Experiments	Reference
MIRT037059	hsa-miR-877-3p	CLASH	23622248
MIRT696741	hsa-miR-3617-5p	HITS-CLIP	23313552
MIRT696740	hsa-miR-641	HITS-CLIP	23313552
MIRT696739	hsa-miR-323a-3p	HITS-CLIP	23313552
MIRT696738	hsa-miR-193a-3p	HITS-CLIP	23313552
MIRT696737	hsa-miR-193b-3p	HITS-CLIP	23313552
MIRT696736	hsa-miR-892b	HITS-CLIP	23313552
MIRT696735	hsa-miR-1207-3p	HITS-CLIP	23313552
MIRT696734	hsa-miR-149-5p	HITS-CLIP	23313552
MIRT696733	hsa-miR-1287-5p	HITS-CLIP	23313552
MIRT696731	hsa-miR-6822-3p	HITS-CLIP	23313552
MIRT696732	hsa-miR-760	HITS-CLIP	23313552
MIRT696730	hsa-miR-208a-3p	HITS-CLIP	23313552
MIRT696729	hsa-miR-208b-3p	HITS-CLIP	23313552
MIRT696728	hsa-miR-499a-5p	HITS-CLIP	23313552
MIRT696727	hsa-miR-6792-5p	HITS-CLIP	23313552
MIRT288082	hsa-miR-4477a	HITS-CLIP	23313552
MIRT696725	hsa-miR-8057	HITS-CLIP	23313552
MIRT696726	hsa-miR-4503	HITS-CLIP	23313552
MIRT696741	hsa-miR-3617-5p	HITS-CLIP	23313552
MIRT696740	hsa-miR-641	HITS-CLIP	23313552
MIRT696739	hsa-miR-323a-3p	HITS-CLIP	23313552
MIRT696738	hsa-miR-193a-3p	HITS-CLIP	23313552
MIRT696737	hsa-miR-193b-3p	HITS-CLIP	23313552
MIRT696736	hsa-miR-892b	HITS-CLIP	23313552
MIRT696735	hsa-miR-1207-3p	HITS-CLIP	23313552
MIRT696734	hsa-miR-149-5p	HITS-CLIP	23313552
MIRT696733	hsa-miR-1287-5p	HITS-CLIP	23313552
MIRT696731	hsa-miR-6822-3p	HITS-CLIP	23313552
MIRT696732	hsa-miR-760	HITS-CLIP	23313552
MIRT696730	hsa-miR-208a-3p	HITS-CLIP	23313552
MIRT696729	hsa-miR-208b-3p	HITS-CLIP	23313552
MIRT696728	hsa-miR-499a-5p	HITS-CLIP	23313552
MIRT696727	hsa-miR-6792-5p	HITS-CLIP	23313552
MIRT288082	hsa-miR-4477a	HITS-CLIP	23313552
MIRT696725	hsa-miR-8057	HITS-CLIP	23313552
MIRT696726	hsa-miR-4503	HITS-CLIP	23313552
MIRT1481179	hsa-miR-1273f	CLIP-seq
MIRT1481180	hsa-miR-134	CLIP-seq
MIRT1481181	hsa-miR-143	CLIP-seq
MIRT1481182	hsa-miR-3074-3p	CLIP-seq
MIRT1481183	hsa-miR-3118	CLIP-seq
MIRT1481184	hsa-miR-3164	CLIP-seq
MIRT1481185	hsa-miR-3682-3p	CLIP-seq
MIRT1481186	hsa-miR-4251	CLIP-seq
MIRT1481187	hsa-miR-4303	CLIP-seq
MIRT1481188	hsa-miR-4329	CLIP-seq
MIRT1481189	hsa-miR-4438	CLIP-seq
MIRT1481190	hsa-miR-4708-5p	CLIP-seq
MIRT1481191	hsa-miR-4753-3p	CLIP-seq
MIRT1481192	hsa-miR-4762-3p	CLIP-seq
MIRT1481193	hsa-miR-4770	CLIP-seq
MIRT1481194	hsa-miR-561	CLIP-seq
MIRT1481195	hsa-miR-581	CLIP-seq
MIRT1481196	hsa-miR-587	CLIP-seq
MIRT1481197	hsa-miR-656	CLIP-seq
MIRT1481198	hsa-miR-758	CLIP-seq
MIRT1481199	hsa-miR-873	CLIP-seq
MIRT1481200	hsa-miR-942	CLIP-seq

Gene ontology (GO) Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0005515	Function	Protein binding	IPI	30021884, 33961781
GO:0005634	Component	Nucleus	IDA	15199122
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005730	Component	Nucleolus	IDA
GO:0005730	Component	Nucleolus	IEA
GO:0006364	Process	RRNA processing	IEA
GO:0031965	Component	Nuclear membrane	IDA
GO:0032040	Component	Small-subunit processome	IBA
GO:0032040	Component	Small-subunit processome	IDA	34516797
GO:0034388	Component	Pwp2p-containing subcomplex of 90S preribosome	IBA
GO:0042274	Process	Ribosomal small subunit biogenesis	IDA	34516797

Other IDs

• MIM: 612816
• HGNC: 24274
• e!Ensembl: ENSG00000011260

Protein

• UniProt ID: Q9Y5J1
• Protein name: U3 small nucleolar RNA-associated protein 18 homolog (WD repeat-containing protein 50)
• Protein function: Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associat
• PDB: 7MQ8 , 7MQ9 , 7MQA
• Sequence:

  MPPERRRRMKLDRRTGAKPKRKPGMRPDWKAGAGPGGPPQKPAPSSQRKPPARPSAAAAA
  IAVAAAEEERRLRQRNRLRLEEDKPAVERCLEELVFGDVENDEDALLRRLRGPRVQEHED
  SGDSEVENEAKGNFPPQKKPVWVDEEDEDEEMVDMMNNRFRKDMMKNASESKLSKDNLKK
  RLKEEFQHAMGGVPAWAETTKRKTSSDDESEEDEDDLLQRTGNFISTSTSLPRGILKMKN
  CQHANAERPTVARISSVQFHPGAQIVMVAGLDNAVSLFQVDGKTNPKIQSIYLERFPIFK
  ACFSANGEEVLATSTHSKVLYVYDMLAGKLIPVHQVRGLKEKIVRSFEVSPDGSFLLING
  IAGYLHLLAMKTKELIGSMKINGRVAASTFSSDSKKVYASSGDGEVYVWDVNSRKCLNRF
  VDEGSLYGLSIATSRNGQYVACGSNCGVVNIYNQDSCLQETNPKPIKAIMNLVTGVTSLT
  FNPTTEILAIASEKMKEAVRLVHLPSCTVFSNFPVIKNKNISHVHTMDFSPRSGYFALGN
  EKGKALMYRLHHYSDF

• Sequence length: 556

Pathways

KEGG Pathway:

Ribosome biogenesis in eukaryotes

Reactome Pathway:

Major pathway of rRNA processing in the nucleolus and cytosol

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (10)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Cervical cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29658574	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25435373		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

RCL1 2 shared pathwaysRibosome biogenesis in eukaryotes, Major pathway of rRNA processing in the nucleolus and cytosol Related via 2 shared pathways including Ribosome biogenesis in eukaryotes, Major pathway of rRNA processing in the nucleolus and cytosol. MPHOSPH10 2 shared pathwaysRibosome biogenesis in eukaryotes, Major pathway of rRNA processing in the nucleolus and cytosol Related via 2 shared pathways including Ribosome biogenesis in eukaryotes, Major pathway of rRNA processing in the nucleolus and cytosol. EMG1 2 shared pathwaysRibosome biogenesis in eukaryotes, Major pathway of rRNA processing in the nucleolus and cytosol Related via 2 shared pathways including Ribosome biogenesis in eukaryotes, Major pathway of rRNA processing in the nucleolus and cytosol. TBL3 2 shared pathwaysRibosome biogenesis in eukaryotes, Major pathway of rRNA processing in the nucleolus and cytosol Related via 2 shared pathways including Ribosome biogenesis in eukaryotes, Major pathway of rRNA processing in the nucleolus and cytosol. UTP14A 2 shared pathwaysRibosome biogenesis in eukaryotes, Major pathway of rRNA processing in the nucleolus and cytosol Related via 2 shared pathways including Ribosome biogenesis in eukaryotes, Major pathway of rRNA processing in the nucleolus and cytosol.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
RCL1	0	[]	2	["Ribosome biogenesis in eukaryotes","Major pathway of rRNA processing in the nucleolus and cytosol"]	0	[]
MPHOSPH10	0	[]	2	["Ribosome biogenesis in eukaryotes","Major pathway of rRNA processing in the nucleolus and cytosol"]	0	[]
EMG1	0	[]	2	["Ribosome biogenesis in eukaryotes","Major pathway of rRNA processing in the nucleolus and cytosol"]	0	[]
TBL3	0	[]	2	["Ribosome biogenesis in eukaryotes","Major pathway of rRNA processing in the nucleolus and cytosol"]	0	[]
UTP14A	0	[]	2	["Ribosome biogenesis in eukaryotes","Major pathway of rRNA processing in the nucleolus and cytosol"]	0	[]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 1 of 5 related genesRCL1 Bipolar disorder Linked via 1 of 5 related genesRCL1 Dementia Linked via 1 of 5 related genesRCL1 Major depressive disorder Linked via 1 of 5 related genesRCL1 Nasopharyngeal neoplasms Linked via 1 of 5 related genesRCL1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	1	["RCL1"]
Bipolar disorder	1	["RCL1"]
Dementia	1	["RCL1"]
Major depressive disorder	1	["RCL1"]
Nasopharyngeal neoplasms	1	["RCL1"]