UQCRHL (ubiquinol-cytochrome c reductase hinge protein like)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 440567
Gene name Ubiquinol-cytochrome c reductase hinge protein like
Gene symbol UQCRHL
Synonyms (NCBI Gene)
hCG25371
Chromosome 1
Chromosome location 1p36.21
Summary This gene has characteristics of a pseudogene derived from the UQCRH gene. However, there is still an open reading frame that could produce a protein of the same or nearly the same size as that of the UQCRH gene, so this gene is being called protein-codin
miRNA miRNA information provided by mirtarbase database.
17 Show/Hide all (17)
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT1476735 hsa-miR-129-5p CLIP-seq
MIRT1476736 hsa-miR-3678-3p CLIP-seq
MIRT1476737 hsa-miR-450b-5p CLIP-seq
MIRT1476738 hsa-miR-4760-5p CLIP-seq
MIRT1476739 hsa-miR-4762-3p CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
8 Show/Hide all (8)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IEA
GO:0005743 Component Mitochondrial inner membrane IEA
GO:0006122 Process Mitochondrial electron transport, ubiquinol to cytochrome c IBA
GO:0006122 Process Mitochondrial electron transport, ubiquinol to cytochrome c IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A096LP55
Protein name Cytochrome b-c1 complex subunit 6-like, mitochondrial
Protein function May be a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This protein may mediate formation of the complex between cytochromes c and c1. {E
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF02320 UCR_hinge 28 → 91 Ubiquinol-cytochrome C reductase hinge protein Family
Sequence 
MGLEDEQKMLTESGDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSR
SHTEEDCTEELFDFLHAKDHCVAHKLFNNLK
Sequence length 91
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Oxidative phosphorylation
Metabolic pathways
Cardiac muscle contraction
Thermogenesis
Non-alcoholic fatty liver disease
Alzheimer disease
Parkinson disease
Amyotrophic lateral sclerosis
Huntington disease
Prion disease
Pathways of neurodegeneration - multiple diseases
Chemical carcinogenesis - reactive oxygen species
Diabetic cardiomyopathy
Sort by:
COX6B2 8 shared pathwaysOxidative phosphorylation, Cardiac muscle contraction, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 8 shared pathways including Oxidative phosphorylation, Cardiac muscle contraction. COX6A2 8 shared pathwaysOxidative phosphorylation, Cardiac muscle contraction, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 8 shared pathways including Oxidative phosphorylation, Cardiac muscle contraction. COX7A1 8 shared pathwaysOxidative phosphorylation, Cardiac muscle contraction, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 8 shared pathways including Oxidative phosphorylation, Cardiac muscle contraction. COX7A2 8 shared pathwaysOxidative phosphorylation, Cardiac muscle contraction, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 8 shared pathways including Oxidative phosphorylation, Cardiac muscle contraction. COX7B2 8 shared pathwaysOxidative phosphorylation, Cardiac muscle contraction, Thermogenesis, Non-alcoholic fatty liver disease, Parkinson disease, Prion disease, Chemical carcinogenesis - reactive oxygen species, Diabetic cardiomyopathy Related via 8 shared pathways including Oxidative phosphorylation, Cardiac muscle contraction.
Cytochrome c oxidase deficiency Linked via 1 of 5 related genesCOX6A2 Mitochondrial complex deficiency Linked via 1 of 5 related genesCOX6A2 Mitochondrial disease Linked via 1 of 5 related genesCOX6A2 Asthma Linked via 1 of 5 related genesCOX7A2 Alzheimer disease Linked via 1 of 5 related genesCOX7B2