TRIM38 (tripartite motif containing 38)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 10475
• Gene name: Tripartite motif containing 38
• Gene symbol: TRIM38
• Synonyms (NCBI Gene): RNF15, RORET
• Chromosome: 6
• Chromosome location: 6p22.2
• Summary: This gene encodes a member of the tripartite motif (TRIM) family. The encoded protein contains a RING-type zinc finger, B box-type zinc finger and SPRY domain. The function of this protein has not been identified. A pseudogene of this gene is located on t

miRNA Show/Hide all (235)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022126	hsa-miR-124-3p	Microarray	18668037
MIRT030670	hsa-miR-21-5p	Microarray	18591254
MIRT646583	hsa-miR-1827	HITS-CLIP	23824327
MIRT646581	hsa-miR-4775	HITS-CLIP	23824327
MIRT646582	hsa-miR-502-5p	HITS-CLIP	23824327
MIRT646579	hsa-miR-6765-5p	HITS-CLIP	23824327
MIRT646580	hsa-miR-1304-5p	HITS-CLIP	23824327
MIRT560613	hsa-miR-34b-3p	PAR-CLIP	20371350
MIRT560612	hsa-miR-4705	PAR-CLIP	20371350
MIRT560611	hsa-miR-600	PAR-CLIP	20371350
MIRT560610	hsa-miR-6077	PAR-CLIP	20371350
MIRT560609	hsa-miR-323a-5p	PAR-CLIP	20371350
MIRT560608	hsa-miR-876-3p	PAR-CLIP	20371350
MIRT560607	hsa-miR-6079	PAR-CLIP	20371350
MIRT560606	hsa-miR-29b-2-5p	PAR-CLIP	20371350
MIRT449809	hsa-miR-586	PAR-CLIP	22100165
MIRT449808	hsa-miR-3913-3p	PAR-CLIP	22100165
MIRT449807	hsa-miR-489-3p	PAR-CLIP	22100165
MIRT449806	hsa-miR-448	PAR-CLIP	22100165
MIRT449805	hsa-miR-1273e	PAR-CLIP	22100165
MIRT734139	hsa-miR-30e-5p	Luciferase reporter assay, Immunoprecipitaion (IP), ELISA	32688283
MIRT646583	hsa-miR-1827	HITS-CLIP	23824327
MIRT646581	hsa-miR-4775	HITS-CLIP	23824327
MIRT646582	hsa-miR-502-5p	HITS-CLIP	23824327
MIRT646579	hsa-miR-6765-5p	HITS-CLIP	23824327
MIRT646580	hsa-miR-1304-5p	HITS-CLIP	23824327
MIRT560613	hsa-miR-34b-3p	PAR-CLIP	20371350
MIRT560612	hsa-miR-4705	PAR-CLIP	20371350
MIRT560611	hsa-miR-600	PAR-CLIP	20371350
MIRT560610	hsa-miR-6077	PAR-CLIP	20371350
MIRT560609	hsa-miR-323a-5p	PAR-CLIP	20371350
MIRT560608	hsa-miR-876-3p	PAR-CLIP	20371350
MIRT560607	hsa-miR-6079	PAR-CLIP	20371350
MIRT560606	hsa-miR-29b-2-5p	PAR-CLIP	20371350
MIRT449809	hsa-miR-586	PAR-CLIP	22100165
MIRT449808	hsa-miR-3913-3p	PAR-CLIP	22100165
MIRT449807	hsa-miR-489-3p	PAR-CLIP	22100165
MIRT449806	hsa-miR-448	PAR-CLIP	22100165
MIRT449805	hsa-miR-1273e	PAR-CLIP	22100165
MIRT1454626	hsa-miR-1273f	CLIP-seq
MIRT1454627	hsa-miR-138	CLIP-seq
MIRT1454628	hsa-miR-197	CLIP-seq
MIRT1454629	hsa-miR-2682	CLIP-seq
MIRT1454630	hsa-miR-3162-3p	CLIP-seq
MIRT1454631	hsa-miR-3187-3p	CLIP-seq
MIRT1454632	hsa-miR-3545-3p	CLIP-seq
MIRT1454633	hsa-miR-3612	CLIP-seq
MIRT1454634	hsa-miR-421	CLIP-seq
MIRT1454635	hsa-miR-4272	CLIP-seq
MIRT1454636	hsa-miR-4275	CLIP-seq
MIRT1454637	hsa-miR-4423-3p	CLIP-seq
MIRT1454638	hsa-miR-4435	CLIP-seq
MIRT1454639	hsa-miR-4438	CLIP-seq
MIRT1454640	hsa-miR-4443	CLIP-seq
MIRT1454641	hsa-miR-449c	CLIP-seq
MIRT1454642	hsa-miR-4534	CLIP-seq
MIRT1454643	hsa-miR-4680-5p	CLIP-seq
MIRT1454644	hsa-miR-4694-5p	CLIP-seq
MIRT1454645	hsa-miR-4701-5p	CLIP-seq
MIRT1454646	hsa-miR-4716-5p	CLIP-seq
MIRT1454647	hsa-miR-4755-3p	CLIP-seq
MIRT1454648	hsa-miR-4756-3p	CLIP-seq
MIRT1454649	hsa-miR-4781-3p	CLIP-seq
MIRT1454650	hsa-miR-4802-5p	CLIP-seq
MIRT1454651	hsa-miR-4803	CLIP-seq
MIRT1454652	hsa-miR-5095	CLIP-seq
MIRT1454653	hsa-miR-5096	CLIP-seq
MIRT1454654	hsa-miR-548s	CLIP-seq
MIRT1454655	hsa-miR-588	CLIP-seq
MIRT1454656	hsa-miR-650	CLIP-seq
MIRT1454657	hsa-miR-653	CLIP-seq
MIRT1454658	hsa-miR-940	CLIP-seq
MIRT2136187	hsa-miR-1301	CLIP-seq
MIRT2136188	hsa-miR-1305	CLIP-seq
MIRT2136189	hsa-miR-3646	CLIP-seq
MIRT2136190	hsa-miR-3662	CLIP-seq
MIRT2136191	hsa-miR-3680	CLIP-seq
MIRT2136192	hsa-miR-3974	CLIP-seq
MIRT2136193	hsa-miR-4660	CLIP-seq
MIRT2136194	hsa-miR-4670-3p	CLIP-seq
MIRT2136195	hsa-miR-4698	CLIP-seq
MIRT2136196	hsa-miR-4798-3p	CLIP-seq
MIRT2136197	hsa-miR-5047	CLIP-seq
MIRT2136198	hsa-miR-590-3p	CLIP-seq
MIRT2136199	hsa-miR-607	CLIP-seq
MIRT2357195	hsa-miR-2277-3p	CLIP-seq
MIRT1454632	hsa-miR-3545-3p	CLIP-seq
MIRT2357196	hsa-miR-3921	CLIP-seq
MIRT2357197	hsa-miR-4427	CLIP-seq
MIRT2357198	hsa-miR-4653-5p	CLIP-seq
MIRT2357199	hsa-miR-4680-3p	CLIP-seq
MIRT1454643	hsa-miR-4680-5p	CLIP-seq
MIRT2136198	hsa-miR-590-3p	CLIP-seq
MIRT1454657	hsa-miR-653	CLIP-seq
MIRT2357200	hsa-miR-942	CLIP-seq
MIRT1454630	hsa-miR-3162-3p	CLIP-seq
MIRT1454628	hsa-miR-197	CLIP-seq
MIRT2462349	hsa-miR-3149	CLIP-seq
MIRT2462350	hsa-miR-411	CLIP-seq
MIRT1454646	hsa-miR-4716-5p	CLIP-seq
MIRT2462351	hsa-miR-4735-5p	CLIP-seq
MIRT1454649	hsa-miR-4781-3p	CLIP-seq
MIRT1454653	hsa-miR-5096	CLIP-seq
MIRT2136198	hsa-miR-590-3p	CLIP-seq
MIRT2462349	hsa-miR-3149	CLIP-seq
MIRT2462350	hsa-miR-411	CLIP-seq
MIRT2462351	hsa-miR-4735-5p	CLIP-seq
MIRT2136198	hsa-miR-590-3p	CLIP-seq
MIRT2650819	hsa-miR-1266	CLIP-seq
MIRT2650820	hsa-miR-1273g	CLIP-seq
MIRT2650821	hsa-miR-127-5p	CLIP-seq
MIRT1454627	hsa-miR-138	CLIP-seq
MIRT2650822	hsa-miR-140-5p	CLIP-seq
MIRT1454628	hsa-miR-197	CLIP-seq
MIRT2650823	hsa-miR-204	CLIP-seq
MIRT2650824	hsa-miR-211	CLIP-seq
MIRT2650825	hsa-miR-2110	CLIP-seq
MIRT2650826	hsa-miR-223	CLIP-seq
MIRT1454629	hsa-miR-2682	CLIP-seq
MIRT2650827	hsa-miR-3120-3p	CLIP-seq
MIRT2462349	hsa-miR-3149	CLIP-seq
MIRT1454630	hsa-miR-3162-3p	CLIP-seq
MIRT1454631	hsa-miR-3187-3p	CLIP-seq
MIRT2650828	hsa-miR-3189-5p	CLIP-seq
MIRT2650829	hsa-miR-342-3p	CLIP-seq
MIRT2650830	hsa-miR-34c-3p	CLIP-seq
MIRT1454632	hsa-miR-3545-3p	CLIP-seq
MIRT2650831	hsa-miR-361-3p	CLIP-seq
MIRT2650832	hsa-miR-3664-3p	CLIP-seq
MIRT2357196	hsa-miR-3921	CLIP-seq
MIRT2650833	hsa-miR-3927	CLIP-seq
MIRT2650834	hsa-miR-3938	CLIP-seq
MIRT2650835	hsa-miR-3973	CLIP-seq
MIRT2462350	hsa-miR-411	CLIP-seq
MIRT2650836	hsa-miR-4271	CLIP-seq
MIRT2650837	hsa-miR-4287	CLIP-seq
MIRT2650838	hsa-miR-4292	CLIP-seq
MIRT1454637	hsa-miR-4423-3p	CLIP-seq
MIRT2357197	hsa-miR-4427	CLIP-seq
MIRT1454638	hsa-miR-4435	CLIP-seq
MIRT2650839	hsa-miR-4469	CLIP-seq
MIRT2650840	hsa-miR-4477a	CLIP-seq
MIRT1454641	hsa-miR-449c	CLIP-seq
MIRT2650841	hsa-miR-4518	CLIP-seq
MIRT1454642	hsa-miR-4534	CLIP-seq
MIRT2650842	hsa-miR-4536	CLIP-seq
MIRT2650843	hsa-miR-455-3p	CLIP-seq
MIRT2650844	hsa-miR-4639-5p	CLIP-seq
MIRT2650845	hsa-miR-4650-3p	CLIP-seq
MIRT2357198	hsa-miR-4653-5p	CLIP-seq
MIRT2650846	hsa-miR-4667-5p	CLIP-seq
MIRT2357199	hsa-miR-4680-3p	CLIP-seq
MIRT1454643	hsa-miR-4680-5p	CLIP-seq
MIRT2650847	hsa-miR-4685-3p	CLIP-seq
MIRT2650848	hsa-miR-4687-3p	CLIP-seq
MIRT2650849	hsa-miR-4697-3p	CLIP-seq
MIRT2650850	hsa-miR-4700-5p	CLIP-seq
MIRT1454645	hsa-miR-4701-5p	CLIP-seq
MIRT1454646	hsa-miR-4716-5p	CLIP-seq
MIRT2650851	hsa-miR-4725-3p	CLIP-seq
MIRT2650852	hsa-miR-4725-5p	CLIP-seq
MIRT2462351	hsa-miR-4735-5p	CLIP-seq
MIRT1454647	hsa-miR-4755-3p	CLIP-seq
MIRT2650853	hsa-miR-4755-5p	CLIP-seq
MIRT2650854	hsa-miR-4758-3p	CLIP-seq
MIRT2650855	hsa-miR-4760-5p	CLIP-seq
MIRT1454649	hsa-miR-4781-3p	CLIP-seq
MIRT2650856	hsa-miR-504	CLIP-seq
MIRT1454653	hsa-miR-5096	CLIP-seq
MIRT2650857	hsa-miR-520g	CLIP-seq
MIRT2650858	hsa-miR-520h	CLIP-seq
MIRT1454654	hsa-miR-548s	CLIP-seq
MIRT2650859	hsa-miR-548u	CLIP-seq
MIRT2650860	hsa-miR-579	CLIP-seq
MIRT1454655	hsa-miR-588	CLIP-seq
MIRT2136198	hsa-miR-590-3p	CLIP-seq
MIRT2650861	hsa-miR-623	CLIP-seq
MIRT2650862	hsa-miR-647	CLIP-seq
MIRT2650863	hsa-miR-660	CLIP-seq
MIRT2650864	hsa-miR-7	CLIP-seq
MIRT1454658	hsa-miR-940	CLIP-seq
MIRT2357200	hsa-miR-942	CLIP-seq
MIRT2650819	hsa-miR-1266	CLIP-seq
MIRT1454628	hsa-miR-197	CLIP-seq
MIRT2650825	hsa-miR-2110	CLIP-seq
MIRT2650826	hsa-miR-223	CLIP-seq
MIRT1454629	hsa-miR-2682	CLIP-seq
MIRT2650827	hsa-miR-3120-3p	CLIP-seq
MIRT2462349	hsa-miR-3149	CLIP-seq
MIRT1454630	hsa-miR-3162-3p	CLIP-seq
MIRT1454631	hsa-miR-3187-3p	CLIP-seq
MIRT2650828	hsa-miR-3189-5p	CLIP-seq
MIRT2650830	hsa-miR-34c-3p	CLIP-seq
MIRT1454632	hsa-miR-3545-3p	CLIP-seq
MIRT2650832	hsa-miR-3664-3p	CLIP-seq
MIRT2650833	hsa-miR-3927	CLIP-seq
MIRT2462350	hsa-miR-411	CLIP-seq
MIRT2650836	hsa-miR-4271	CLIP-seq
MIRT2650837	hsa-miR-4287	CLIP-seq
MIRT2650838	hsa-miR-4292	CLIP-seq
MIRT1454637	hsa-miR-4423-3p	CLIP-seq
MIRT1454638	hsa-miR-4435	CLIP-seq
MIRT2650839	hsa-miR-4469	CLIP-seq
MIRT2650840	hsa-miR-4477a	CLIP-seq
MIRT1454641	hsa-miR-449c	CLIP-seq
MIRT2650841	hsa-miR-4518	CLIP-seq
MIRT1454642	hsa-miR-4534	CLIP-seq
MIRT2650842	hsa-miR-4536	CLIP-seq
MIRT2650843	hsa-miR-455-3p	CLIP-seq
MIRT2650845	hsa-miR-4650-3p	CLIP-seq
MIRT2650846	hsa-miR-4667-5p	CLIP-seq
MIRT1454643	hsa-miR-4680-5p	CLIP-seq
MIRT2650847	hsa-miR-4685-3p	CLIP-seq
MIRT2650848	hsa-miR-4687-3p	CLIP-seq
MIRT2650849	hsa-miR-4697-3p	CLIP-seq
MIRT2650850	hsa-miR-4700-5p	CLIP-seq
MIRT1454645	hsa-miR-4701-5p	CLIP-seq
MIRT1454646	hsa-miR-4716-5p	CLIP-seq
MIRT2650851	hsa-miR-4725-3p	CLIP-seq
MIRT2650852	hsa-miR-4725-5p	CLIP-seq
MIRT2462351	hsa-miR-4735-5p	CLIP-seq
MIRT1454647	hsa-miR-4755-3p	CLIP-seq
MIRT2650854	hsa-miR-4758-3p	CLIP-seq
MIRT2650855	hsa-miR-4760-5p	CLIP-seq
MIRT1454649	hsa-miR-4781-3p	CLIP-seq
MIRT2694179	hsa-miR-4797-3p	CLIP-seq
MIRT2650856	hsa-miR-504	CLIP-seq
MIRT1454653	hsa-miR-5096	CLIP-seq
MIRT1454654	hsa-miR-548s	CLIP-seq
MIRT2650859	hsa-miR-548u	CLIP-seq
MIRT1454655	hsa-miR-588	CLIP-seq
MIRT2136198	hsa-miR-590-3p	CLIP-seq
MIRT2650862	hsa-miR-647	CLIP-seq
MIRT2650863	hsa-miR-660	CLIP-seq
MIRT1454658	hsa-miR-940	CLIP-seq

Gene ontology (GO) Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0003713	Function	Transcription coactivator activity	IDA	23077300
GO:0005515	Function	Protein binding	IPI	23275563, 25416956, 25910212, 29892012, 31515488, 32296183, 32814053
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0008270	Function	Zinc ion binding	IEA
GO:0010468	Process	Regulation of gene expression	IBA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0016567	Process	Protein ubiquitination	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0016925	Process	Protein sumoylation	IEA
GO:0032648	Process	Regulation of interferon-beta production	IEA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	HMP	12761501
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IBA
GO:0043123	Process	Positive regulation of canonical NF-kappaB signal transduction	IDA	23077300
GO:0043161	Process	Proteasome-mediated ubiquitin-dependent protein catabolic process	IEA
GO:0045070	Process	Positive regulation of viral genome replication	IEA
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0046596	Process	Regulation of viral entry into host cell	IBA
GO:0046598	Process	Positive regulation of viral entry into host cell	IDA	18248090
GO:0046872	Function	Metal ion binding	IEA
GO:0048524	Process	Positive regulation of viral process	IEA
GO:0050687	Process	Negative regulation of defense response to virus	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	IBA
GO:0061630	Function	Ubiquitin protein ligase activity	IEA
GO:0061630	Function	Ubiquitin protein ligase activity	ISS
GO:0070936	Process	Protein K48-linked ubiquitination	IEA
GO:1903900	Process	Regulation of viral life cycle	IEA

Other IDs

• MIM: HGNC
• HGNC: N/A
• e!Ensembl: HGNC

Protein

• UniProt ID: O00635
• Protein name: E3 ubiquitin-protein ligase TRIM38 (EC 2.3.2.27) (RING finger protein 15) (Tripartite motif-containing protein 38) (Zinc finger protein RoRet)
• Protein function: E3 ubiquitin-protein and E3 SUMO-protein ligase that acts as a regulator of innate immunity (PubMed:23056470). Acts as a negative regulator of type I interferon IFN-beta production by catalyzing 'Lys-48'-linked polyubiquitination of AZI2/NAP1, l
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00622	SPRY	346 → 458	SPRY domain	Family
  PF00643	zf-B_box	88 → 129	B-box zinc finger	Domain
  PF13765	PRY	294 → 342	SPRY-associated domain	Family
  PF15227	zf-C3HC4_4	16 → 62		Domain

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:9149941}.
• Sequence:

  MASTTSTKKMMEEATCSICLSLMTNPVSINCGHSYCHLCITDFFKNPSQKQLRQETFCCP
  QCRAPFHMDSLRPNKQLGSLIEALKETDQEMSCEEHGEQFHLFCEDEGQLICWRCERAPQ
  HKGHTTALVEDVCQGYKEKLQKAVTKLKQLEDRCTEQKLSTAMRITKWKEKVQIQRQKIR
  SDFKNLQCFLHEEEKSYLWRLEKEEQQTLSRLRDYEAGLGLKSNELKSHILELEEKCQGS
  AQKLLQNVNDTLSRSWAVKLETSEAVSLELHTMCNVSKLYFDVKKMLRSHQVSVTLDPDT
  AHHELILSEDRRQVTRGYTQENQDTSSRRFTAFPCVLGCEGFTSGRRYFEVDVGEGTGWD
  LGVCMENVQRGTGMKQEPQSGFWTLRLCKKKGYVALTSPPTSLHLHEQPLLVGIFLDYEA
  GVVSFYNGNTGCHIFTFPKASFSDTLRPYFQVYQYSPLFLPPPGD

• Sequence length: 465

Pathways

Reactome Pathway:

Interferon gamma signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BREAST CANCER	—	GWAS catalog	36819030	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	40465716	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	36819030	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OCULAR HYPERTENSION	—	GWAS catalog	36222912	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	27082954	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (9)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis, Gouty	Gouty arthritis	GWASDB_DG	20884846, 21768215, 23263486		★☆☆☆☆ Found in Text Mining only
Gout	Gout	GWASDB_DG	20884846, 21768215, 23263486		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hemochromatosis	Hemochromatosis	Pubtator	9149941	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	9149941		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	9149941		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	12047754, 9149941		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	9149941		★☆☆☆☆ Found in Text Mining only
Peritonitis	Peritonitis	Pubtator	35022662	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34906161	Inhibit	★☆☆☆☆ Found in Text Mining only

Related Genes

VWA8 2 shared diseasesOcular hypertension, Peripheral arterial disease 2 shared evidence sourcesGWAS catalog (Ocular hypertension), GWAS catalog (Peripheral arterial disease) Related via 2 shared diseases including Ocular hypertension, Peripheral arterial disease — evidence mostly GWAS catalog.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
VWA8	2	["Ocular hypertension","Peripheral arterial disease"]	0	[]	2	["GWAS catalog (Ocular hypertension)","GWAS catalog (Peripheral arterial disease)"]

Diseases Linked via Similar Genes

Alzheimer disease Linked via 1 of 1 related geneVWA8 Androgenetic alopecia Linked via 1 of 1 related geneVWA8 Autism Linked via 1 of 1 related geneVWA8 Developmental delay Linked via 1 of 1 related geneVWA8 Multiple sclerosis Linked via 1 of 1 related geneVWA8

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Alzheimer disease	1	["VWA8"]
Androgenetic alopecia	1	["VWA8"]
Autism	1	["VWA8"]
Developmental delay	1	["VWA8"]
Multiple sclerosis	1	["VWA8"]