TRIB3 (tribbles pseudokinase 3)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 57761
• Gene name: Tribbles pseudokinase 3
• Gene symbol: TRIB3
• Synonyms (NCBI Gene): C20orf97, NIPK, SINK, SKIP3, TRB3
• Chromosome: 20
• Chromosome location: 20p13
• Summary: The protein encoded by this gene is a putative protein kinase that is induced by the transcription factor NF-kappaB. The encoded protein is a negative regulator of NF-kappaB and can also sensitize cells to TNF- and TRAIL-induced apoptosis. In addition, th

miRNA Show/Hide all (309)

miRTarBase ID	miRNA	Experiments	Reference
MIRT003354	hsa-miR-24-3p	qRT-PCR, Western blot	20019669
MIRT019155	hsa-miR-335-5p	Microarray	18185580
MIRT023198	hsa-miR-124-3p	Microarray	18668037
MIRT024900	hsa-miR-215-5p	Microarray	19074876
MIRT026958	hsa-miR-192-5p	Microarray	19074876
MIRT030272	hsa-miR-26b-5p	Microarray	19088304
MIRT003354	hsa-miR-24-3p	Microarray	19748357
MIRT049873	hsa-miR-31-5p	CLASH	23622248
MIRT438742	hsa-miR-219a-5p	qRT-PCR	24974767
MIRT438742	hsa-miR-219a-5p	qRT-PCR	24974767
MIRT438129	hsa-miR-96-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	24375867
MIRT438129	hsa-miR-96-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	24375867
MIRT438742	hsa-miR-219a-5p	qRT-PCR	24974767
MIRT438742	hsa-miR-219a-5p	qRT-PCR	24974767
MIRT438129	hsa-miR-96-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	24375867
MIRT438129	hsa-miR-96-5p	Immunoblot, Luciferase reporter assay, qRT-PCR	24375867
MIRT023198	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT465294	hsa-miR-4464	PAR-CLIP	20371350
MIRT465293	hsa-miR-4748	PAR-CLIP	20371350
MIRT561426	hsa-miR-1237-3p	PAR-CLIP	20371350
MIRT561425	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT561424	hsa-miR-6128	PAR-CLIP	20371350
MIRT370117	hsa-miR-605-3p	PAR-CLIP	20371350
MIRT465287	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT561423	hsa-miR-4533	PAR-CLIP	20371350
MIRT561422	hsa-miR-3202	PAR-CLIP	20371350
MIRT465286	hsa-miR-4284	PAR-CLIP	20371350
MIRT003354	hsa-miR-24-3p	PAR-CLIP	20371350
MIRT561421	hsa-miR-1299	PAR-CLIP	20371350
MIRT561420	hsa-miR-516b-5p	PAR-CLIP	20371350
MIRT561419	hsa-miR-4782-5p	PAR-CLIP	20371350
MIRT561418	hsa-miR-5706	PAR-CLIP	20371350
MIRT465285	hsa-miR-8057	PAR-CLIP	20371350
MIRT023198	hsa-miR-124-3p	PAR-CLIP	23592263
MIRT370131	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT370133	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT370119	hsa-miR-940	PAR-CLIP	23592263
MIRT465294	hsa-miR-4464	PAR-CLIP	23592263
MIRT465293	hsa-miR-4748	PAR-CLIP	23592263
MIRT465292	hsa-miR-5000-5p	PAR-CLIP	23592263
MIRT465291	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT465290	hsa-miR-4257	PAR-CLIP	23592263
MIRT370126	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT465289	hsa-miR-584-3p	PAR-CLIP	23592263
MIRT465288	hsa-miR-4277	PAR-CLIP	23592263
MIRT465287	hsa-miR-493-3p	PAR-CLIP	23592263
MIRT370129	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT370120	hsa-miR-1827	PAR-CLIP	23592263
MIRT370125	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT370121	hsa-miR-4434	PAR-CLIP	23592263
MIRT370123	hsa-miR-4516	PAR-CLIP	23592263
MIRT370127	hsa-miR-5703	PAR-CLIP	23592263
MIRT465286	hsa-miR-4284	PAR-CLIP	23592263
MIRT003354	hsa-miR-24-3p	PAR-CLIP	23592263
MIRT465285	hsa-miR-8057	PAR-CLIP	23592263
MIRT023198	hsa-miR-124-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27845424
MIRT023198	hsa-miR-124-3p	PAR-CLIP	20371350
MIRT465294	hsa-miR-4464	PAR-CLIP	20371350
MIRT465293	hsa-miR-4748	PAR-CLIP	20371350
MIRT561426	hsa-miR-1237-3p	PAR-CLIP	20371350
MIRT561425	hsa-miR-875-3p	PAR-CLIP	20371350
MIRT561424	hsa-miR-6128	PAR-CLIP	20371350
MIRT370117	hsa-miR-605-3p	PAR-CLIP	20371350
MIRT465287	hsa-miR-493-3p	PAR-CLIP	20371350
MIRT561423	hsa-miR-4533	PAR-CLIP	20371350
MIRT561422	hsa-miR-3202	PAR-CLIP	20371350
MIRT465286	hsa-miR-4284	PAR-CLIP	20371350
MIRT003354	hsa-miR-24-3p	PAR-CLIP	20371350
MIRT561421	hsa-miR-1299	PAR-CLIP	20371350
MIRT561420	hsa-miR-516b-5p	PAR-CLIP	20371350
MIRT561419	hsa-miR-4782-5p	PAR-CLIP	20371350
MIRT561418	hsa-miR-5706	PAR-CLIP	20371350
MIRT465285	hsa-miR-8057	PAR-CLIP	20371350
MIRT023198	hsa-miR-124-3p	PAR-CLIP	23592263
MIRT370131	hsa-miR-6808-5p	PAR-CLIP	23592263
MIRT370133	hsa-miR-6893-5p	PAR-CLIP	23592263
MIRT370119	hsa-miR-940	PAR-CLIP	23592263
MIRT465294	hsa-miR-4464	PAR-CLIP	23592263
MIRT465293	hsa-miR-4748	PAR-CLIP	23592263
MIRT465292	hsa-miR-5000-5p	PAR-CLIP	23592263
MIRT465291	hsa-miR-6847-5p	PAR-CLIP	23592263
MIRT465290	hsa-miR-4257	PAR-CLIP	23592263
MIRT370126	hsa-miR-4768-3p	PAR-CLIP	23592263
MIRT465289	hsa-miR-584-3p	PAR-CLIP	23592263
MIRT465288	hsa-miR-4277	PAR-CLIP	23592263
MIRT465287	hsa-miR-493-3p	PAR-CLIP	23592263
MIRT370129	hsa-miR-6770-5p	PAR-CLIP	23592263
MIRT370120	hsa-miR-1827	PAR-CLIP	23592263
MIRT370125	hsa-miR-4722-5p	PAR-CLIP	23592263
MIRT370121	hsa-miR-4434	PAR-CLIP	23592263
MIRT370123	hsa-miR-4516	PAR-CLIP	23592263
MIRT370127	hsa-miR-5703	PAR-CLIP	23592263
MIRT465286	hsa-miR-4284	PAR-CLIP	23592263
MIRT003354	hsa-miR-24-3p	PAR-CLIP	23592263
MIRT465285	hsa-miR-8057	PAR-CLIP	23592263
MIRT1452813	hsa-miR-1237	CLIP-seq
MIRT1452814	hsa-miR-124	CLIP-seq
MIRT1452815	hsa-miR-1245b-5p	CLIP-seq
MIRT1452816	hsa-miR-1254	CLIP-seq
MIRT1452817	hsa-miR-1271	CLIP-seq
MIRT1452818	hsa-miR-1295	CLIP-seq
MIRT1452819	hsa-miR-132	CLIP-seq
MIRT1452820	hsa-miR-182	CLIP-seq
MIRT1452821	hsa-miR-204	CLIP-seq
MIRT1452822	hsa-miR-211	CLIP-seq
MIRT1452823	hsa-miR-212	CLIP-seq
MIRT1452824	hsa-miR-216b	CLIP-seq
MIRT1452825	hsa-miR-30a	CLIP-seq
MIRT1452826	hsa-miR-30b	CLIP-seq
MIRT1452827	hsa-miR-30c	CLIP-seq
MIRT1452828	hsa-miR-30d	CLIP-seq
MIRT1452829	hsa-miR-30e	CLIP-seq
MIRT1452830	hsa-miR-3116	CLIP-seq
MIRT1452831	hsa-miR-3142	CLIP-seq
MIRT1452832	hsa-miR-3180-5p	CLIP-seq
MIRT1452833	hsa-miR-3189-5p	CLIP-seq
MIRT1452834	hsa-miR-3612	CLIP-seq
MIRT1452835	hsa-miR-3622a-5p	CLIP-seq
MIRT1452836	hsa-miR-3907	CLIP-seq
MIRT1452837	hsa-miR-3921	CLIP-seq
MIRT1452838	hsa-miR-4287	CLIP-seq
MIRT1452839	hsa-miR-4323	CLIP-seq
MIRT1452840	hsa-miR-4423-3p	CLIP-seq
MIRT1452841	hsa-miR-4424	CLIP-seq
MIRT1452842	hsa-miR-4428	CLIP-seq
MIRT1452843	hsa-miR-4443	CLIP-seq
MIRT1452844	hsa-miR-4469	CLIP-seq
MIRT1452845	hsa-miR-4653-5p	CLIP-seq
MIRT1452846	hsa-miR-4685-3p	CLIP-seq
MIRT1452847	hsa-miR-4711-5p	CLIP-seq
MIRT1452848	hsa-miR-4768-5p	CLIP-seq
MIRT1452849	hsa-miR-4773	CLIP-seq
MIRT1452850	hsa-miR-493	CLIP-seq
MIRT1452851	hsa-miR-506	CLIP-seq
MIRT1452852	hsa-miR-516b	CLIP-seq
MIRT1452853	hsa-miR-520a-5p	CLIP-seq
MIRT1452854	hsa-miR-525-5p	CLIP-seq
MIRT1452855	hsa-miR-526b	CLIP-seq
MIRT1452856	hsa-miR-650	CLIP-seq
MIRT1452857	hsa-miR-875-5p	CLIP-seq
MIRT1452858	hsa-miR-96	CLIP-seq
MIRT2135614	hsa-miR-1178	CLIP-seq
MIRT1452815	hsa-miR-1245b-5p	CLIP-seq
MIRT1452816	hsa-miR-1254	CLIP-seq
MIRT1452817	hsa-miR-1271	CLIP-seq
MIRT1452818	hsa-miR-1295	CLIP-seq
MIRT2135615	hsa-miR-147	CLIP-seq
MIRT1452824	hsa-miR-216b	CLIP-seq
MIRT2135616	hsa-miR-217	CLIP-seq
MIRT2135617	hsa-miR-219-1-3p	CLIP-seq
MIRT2135618	hsa-miR-3065-3p	CLIP-seq
MIRT1452825	hsa-miR-30a	CLIP-seq
MIRT1452826	hsa-miR-30b	CLIP-seq
MIRT1452827	hsa-miR-30c	CLIP-seq
MIRT1452828	hsa-miR-30d	CLIP-seq
MIRT1452829	hsa-miR-30e	CLIP-seq
MIRT1452830	hsa-miR-3116	CLIP-seq
MIRT2135619	hsa-miR-3121-5p	CLIP-seq
MIRT1452831	hsa-miR-3142	CLIP-seq
MIRT2135620	hsa-miR-3190	CLIP-seq
MIRT2135621	hsa-miR-330-3p	CLIP-seq
MIRT1452835	hsa-miR-3622a-5p	CLIP-seq
MIRT2135622	hsa-miR-3911	CLIP-seq
MIRT2135623	hsa-miR-4279	CLIP-seq
MIRT2135624	hsa-miR-4421	CLIP-seq
MIRT1452840	hsa-miR-4423-3p	CLIP-seq
MIRT1452842	hsa-miR-4428	CLIP-seq
MIRT2135625	hsa-miR-4468	CLIP-seq
MIRT2135626	hsa-miR-4677-3p	CLIP-seq
MIRT2135627	hsa-miR-4679	CLIP-seq
MIRT2135628	hsa-miR-4682	CLIP-seq
MIRT2135629	hsa-miR-4718	CLIP-seq
MIRT2135630	hsa-miR-4725-5p	CLIP-seq
MIRT2135631	hsa-miR-500a	CLIP-seq
MIRT2135632	hsa-miR-504	CLIP-seq
MIRT2135633	hsa-miR-571	CLIP-seq
MIRT2135634	hsa-miR-576-3p	CLIP-seq
MIRT2135635	hsa-miR-644	CLIP-seq
MIRT2135636	hsa-miR-873	CLIP-seq
MIRT1452858	hsa-miR-96	CLIP-seq
MIRT2135614	hsa-miR-1178	CLIP-seq
MIRT1452813	hsa-miR-1237	CLIP-seq
MIRT1452814	hsa-miR-124	CLIP-seq
MIRT1452816	hsa-miR-1254	CLIP-seq
MIRT1452817	hsa-miR-1271	CLIP-seq
MIRT1452819	hsa-miR-132	CLIP-seq
MIRT1452823	hsa-miR-212	CLIP-seq
MIRT2356752	hsa-miR-2355-5p	CLIP-seq
MIRT2356753	hsa-miR-24	CLIP-seq
MIRT2135618	hsa-miR-3065-3p	CLIP-seq
MIRT1452825	hsa-miR-30a	CLIP-seq
MIRT1452826	hsa-miR-30b	CLIP-seq
MIRT1452827	hsa-miR-30c	CLIP-seq
MIRT1452828	hsa-miR-30d	CLIP-seq
MIRT1452829	hsa-miR-30e	CLIP-seq
MIRT1452830	hsa-miR-3116	CLIP-seq
MIRT2135619	hsa-miR-3121-5p	CLIP-seq
MIRT2356754	hsa-miR-3158-3p	CLIP-seq
MIRT2356755	hsa-miR-3161	CLIP-seq
MIRT2356756	hsa-miR-3177-5p	CLIP-seq
MIRT2356757	hsa-miR-3622a-3p	CLIP-seq
MIRT1452835	hsa-miR-3622a-5p	CLIP-seq
MIRT2356758	hsa-miR-3622b-3p	CLIP-seq
MIRT2356759	hsa-miR-3657	CLIP-seq
MIRT2356760	hsa-miR-3690	CLIP-seq
MIRT1452838	hsa-miR-4287	CLIP-seq
MIRT1452840	hsa-miR-4423-3p	CLIP-seq
MIRT1452841	hsa-miR-4424	CLIP-seq
MIRT2135625	hsa-miR-4468	CLIP-seq
MIRT1452844	hsa-miR-4469	CLIP-seq
MIRT2356761	hsa-miR-4511	CLIP-seq
MIRT2356762	hsa-miR-4523	CLIP-seq
MIRT2356763	hsa-miR-4650-5p	CLIP-seq
MIRT2356764	hsa-miR-4672	CLIP-seq
MIRT2135626	hsa-miR-4677-3p	CLIP-seq
MIRT2135627	hsa-miR-4679	CLIP-seq
MIRT1452846	hsa-miR-4685-3p	CLIP-seq
MIRT2356765	hsa-miR-4713-5p	CLIP-seq
MIRT2356766	hsa-miR-4727-5p	CLIP-seq
MIRT1452849	hsa-miR-4773	CLIP-seq
MIRT1452850	hsa-miR-493	CLIP-seq
MIRT1452851	hsa-miR-506	CLIP-seq
MIRT1452852	hsa-miR-516b	CLIP-seq
MIRT1452855	hsa-miR-526b	CLIP-seq
MIRT2135634	hsa-miR-576-3p	CLIP-seq
MIRT2356767	hsa-miR-711	CLIP-seq
MIRT1452858	hsa-miR-96	CLIP-seq
MIRT2396340	hsa-miR-3136-3p	CLIP-seq
MIRT2396341	hsa-miR-605	CLIP-seq
MIRT1452814	hsa-miR-124	CLIP-seq
MIRT2356753	hsa-miR-24	CLIP-seq
MIRT1452850	hsa-miR-493	CLIP-seq
MIRT1452851	hsa-miR-506	CLIP-seq
MIRT2462315	hsa-miR-1912	CLIP-seq
MIRT2462316	hsa-miR-199a-5p	CLIP-seq
MIRT2462317	hsa-miR-199b-5p	CLIP-seq
MIRT2462318	hsa-miR-3130-5p	CLIP-seq
MIRT2462319	hsa-miR-4280	CLIP-seq
MIRT2462320	hsa-miR-4482	CLIP-seq
MIRT2462321	hsa-miR-520d-5p	CLIP-seq
MIRT2462322	hsa-miR-520g	CLIP-seq
MIRT2462323	hsa-miR-520h	CLIP-seq
MIRT2462324	hsa-miR-524-5p	CLIP-seq
MIRT1452816	hsa-miR-1254	CLIP-seq
MIRT1452821	hsa-miR-204	CLIP-seq
MIRT1452822	hsa-miR-211	CLIP-seq
MIRT1452830	hsa-miR-3116	CLIP-seq
MIRT1452832	hsa-miR-3180-5p	CLIP-seq
MIRT1452833	hsa-miR-3189-5p	CLIP-seq
MIRT2356760	hsa-miR-3690	CLIP-seq
MIRT1452836	hsa-miR-3907	CLIP-seq
MIRT1452837	hsa-miR-3921	CLIP-seq
MIRT1452838	hsa-miR-4287	CLIP-seq
MIRT1452839	hsa-miR-4323	CLIP-seq
MIRT2135624	hsa-miR-4421	CLIP-seq
MIRT2356763	hsa-miR-4650-5p	CLIP-seq
MIRT1452845	hsa-miR-4653-5p	CLIP-seq
MIRT1452846	hsa-miR-4685-3p	CLIP-seq
MIRT2650245	hsa-miR-4714-3p	CLIP-seq
MIRT2135630	hsa-miR-4725-5p	CLIP-seq
MIRT2650246	hsa-miR-4766-5p	CLIP-seq
MIRT1452848	hsa-miR-4768-5p	CLIP-seq
MIRT1452849	hsa-miR-4773	CLIP-seq
MIRT2135631	hsa-miR-500a	CLIP-seq
MIRT2135632	hsa-miR-504	CLIP-seq
MIRT1452853	hsa-miR-520a-5p	CLIP-seq
MIRT1452854	hsa-miR-525-5p	CLIP-seq
MIRT2650247	hsa-miR-563	CLIP-seq
MIRT2356767	hsa-miR-711	CLIP-seq
MIRT1452857	hsa-miR-875-5p	CLIP-seq
MIRT2694109	hsa-miR-1207-3p	CLIP-seq
MIRT1452816	hsa-miR-1254	CLIP-seq
MIRT1452819	hsa-miR-132	CLIP-seq
MIRT1452821	hsa-miR-204	CLIP-seq
MIRT1452822	hsa-miR-211	CLIP-seq
MIRT1452823	hsa-miR-212	CLIP-seq
MIRT1452830	hsa-miR-3116	CLIP-seq
MIRT1452832	hsa-miR-3180-5p	CLIP-seq
MIRT1452833	hsa-miR-3189-5p	CLIP-seq
MIRT2356760	hsa-miR-3690	CLIP-seq
MIRT2694110	hsa-miR-3714	CLIP-seq
MIRT1452836	hsa-miR-3907	CLIP-seq
MIRT1452837	hsa-miR-3921	CLIP-seq
MIRT1452838	hsa-miR-4287	CLIP-seq
MIRT2694111	hsa-miR-4320	CLIP-seq
MIRT1452839	hsa-miR-4323	CLIP-seq
MIRT2135624	hsa-miR-4421	CLIP-seq
MIRT1452841	hsa-miR-4424	CLIP-seq
MIRT2356761	hsa-miR-4511	CLIP-seq
MIRT2356763	hsa-miR-4650-5p	CLIP-seq
MIRT1452845	hsa-miR-4653-5p	CLIP-seq
MIRT1452846	hsa-miR-4685-3p	CLIP-seq
MIRT2650245	hsa-miR-4714-3p	CLIP-seq
MIRT2135630	hsa-miR-4725-5p	CLIP-seq
MIRT2650246	hsa-miR-4766-5p	CLIP-seq
MIRT1452848	hsa-miR-4768-5p	CLIP-seq
MIRT1452849	hsa-miR-4773	CLIP-seq
MIRT2135631	hsa-miR-500a	CLIP-seq
MIRT2135632	hsa-miR-504	CLIP-seq
MIRT1452853	hsa-miR-520a-5p	CLIP-seq
MIRT2462321	hsa-miR-520d-5p	CLIP-seq
MIRT2462324	hsa-miR-524-5p	CLIP-seq
MIRT1452854	hsa-miR-525-5p	CLIP-seq
MIRT1452855	hsa-miR-526b	CLIP-seq
MIRT2694112	hsa-miR-548an	CLIP-seq
MIRT2694113	hsa-miR-548m	CLIP-seq
MIRT2650247	hsa-miR-563	CLIP-seq
MIRT2356767	hsa-miR-711	CLIP-seq
MIRT1452857	hsa-miR-875-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATF4	Activation	15775988
ATF4	Unknown	20592469;21220698
DDIT3	Activation	15775988;18940792
RELA	Repression	12736262

Gene ontology (GO) Show/Hide all (48)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	15775988
GO:0003714	Function	Transcription corepressor activity	IEA
GO:0003714	Function	Transcription corepressor activity	ISS
GO:0004860	Function	Protein kinase inhibitor activity	IDA	15299019
GO:0004860	Function	Protein kinase inhibitor activity	IEA
GO:0005515	Function	Protein binding	IPI	12743605, 15775988, 16147992, 17872950, 20211142, 23455924, 25416956, 25910212, 32296183, 32814053, 33961781
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	TAS
GO:0005886	Component	Plasma membrane	TAS
GO:0006915	Process	Apoptotic process	IEA
GO:0010506	Process	Regulation of autophagy	IEA
GO:0010506	Process	Regulation of autophagy	ISS
GO:0010827	Process	Regulation of D-glucose transmembrane transport	IEA
GO:0010827	Process	Regulation of D-glucose transmembrane transport	ISS	12791994
GO:0016301	Function	Kinase activity	IDA	12743605
GO:0019899	Function	Enzyme binding	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	12791994, 15299019
GO:0019901	Function	Protein kinase binding	ISS
GO:0030291	Function	Protein serine/threonine kinase inhibitor activity	IDA	12791994
GO:0031398	Process	Positive regulation of protein ubiquitination	IEA
GO:0031398	Process	Positive regulation of protein ubiquitination	ISS	16794074
GO:0031434	Function	Mitogen-activated protein kinase kinase binding	IBA
GO:0031625	Function	Ubiquitin protein ligase binding	IEA
GO:0031625	Function	Ubiquitin protein ligase binding	ISS	16794074
GO:0032436	Process	Positive regulation of proteasomal ubiquitin-dependent protein catabolic process	IBA
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032869	Process	Cellular response to insulin stimulus	ISS	12791994
GO:0034976	Process	Response to endoplasmic reticulum stress	IDA	15775988
GO:0043405	Process	Regulation of MAP kinase activity	IDA	15299019
GO:0043409	Process	Negative regulation of MAPK cascade	IMP	15299019
GO:0045599	Process	Negative regulation of fat cell differentiation	IEA
GO:0045599	Process	Negative regulation of fat cell differentiation	ISS	17576771
GO:0045717	Process	Negative regulation of fatty acid biosynthetic process	IEA
GO:0045717	Process	Negative regulation of fatty acid biosynthetic process	ISS	16794074
GO:0045892	Process	Negative regulation of DNA-templated transcription	IMP	15775988
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IDA	12791994
GO:0055106	Function	Ubiquitin-protein transferase regulator activity	IEA
GO:0055106	Function	Ubiquitin-protein transferase regulator activity	ISS	20410507
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IDA	15775988
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	22934019
GO:1990757	Function	Ubiquitin ligase activator activity	IEA
GO:1990757	Function	Ubiquitin ligase activator activity	ISS	16794074

Other IDs

• MIM: 607898
• HGNC: 16228
• e!Ensembl: ENSG00000101255

Protein

• UniProt ID: Q96RU7
• Protein name: Tribbles homolog 3 (TRB-3) (Neuronal cell death-inducible putative kinase) (SINK) (p65-interacting inhibitor of NF-kappa-B)
• Protein function: Inactive protein kinase which acts as a regulator of the integrated stress response (ISR), a process for adaptation to various stress (PubMed:15775988, PubMed:15781252). Inhibits the transcriptional activity of DDIT3/CHOP and is involved in DDIT
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00069	Pkinase	78 → 315	Protein kinase domain	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highest expression in liver, pancreas, peripheral blood leukocytes and bone marrow. Also highly expressed in a number of primary lung, colon and breast tumors. Expressed in spleen, thymus, and prostate and is undetectable in other exam
• Sequence:

  MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRAT
  AVATASRLGPYVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHV
  ARPTEVLAGTQLLYAFFTRTHGDMHSLVRSRHRIPEPEAAVLFRQMATALAHCHQHGLVL
  RDLKLCRFVFADRERKKLVLENLEDSCVLTGPDDSLWDKHACPAYVGPEILSSRASYSGK
  AADVWSLGVALFTMLAGHYPFQDSEPVLLFGKIRRGAYALPAGLSAPARCLVRCLLRREP
  AERLTATGILLHPWLRQDPMPLAPTRSHLWEAAQVVPDGLGLDEAREEEGDREVVLYG

• Sequence length: 358

Pathways

KEGG Pathway	Reactome Pathway
Insulin resistance	PIP3 activates AKT signaling
	Activation of AKT2
	PPARA activates gene expression
	Negative regulation of the PI3K/AKT network
	CD28 dependent PI3K/Akt signaling
	VEGFR2 mediated vascular permeability

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (9)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
BLOOD COAGULATION DISEASE	—	GWAS catalog	39024449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHIES	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOMYOPATHY	—	GenCC	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	20461355	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, PROMYELOCYTIC, ACUTE	—	CTD	32929351	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	CTD	18497449	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME X	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	29289645	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (122)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	28486101, 28486108, 31235507, 31405833		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23632994, 31256425		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	29511103	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	20693163, 22577090, 26517932, 26855171		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	28790132	Stimulate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	20693163, 22577090, 26517932, 26855171		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	26253791, 34051802	Associate	★☆☆☆☆ Found in Text Mining only
ATRICHIA WITH PAPULAR LESIONS	Atrichia With Papular Lesions	BEFREE	28486101, 28486108		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	20139130		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	21704407, 21864376, 23185332, 23319603, 23558942, 30678233, 30763339, 31844113		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21704407, 23185332, 23558942, 30763339, 36142452	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32160655	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23632994, 28184934, 31562867		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33896816, 35726370, 37153569, 37189176, 38006403	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	35728000	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	29079702		★☆☆☆☆ Found in Text Mining only
Cardiovascular Abnormalities	Cardiovascular Abnormalities	BEFREE	22577090		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	22577090, 23505291, 26517932, 29025897		★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	19389818	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	19389818, 26868433		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	28782643		★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	38254916	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	29025897		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	30365932		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	19904274, 23632994, 30365932		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19904274, 28105922	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	30365932		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30745845		★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	18436806, 26253791		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	18436806, 26253791		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	26253791, 35152560	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	18436806, 26253791		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	19180501		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	19996382, 20461355, 26855171, 27207527		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	19996382, 20461355, 26855171, 27207527		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	26253791, 35465829	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	18984671, 20393693, 23633196, 25463099, 26253791	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28600485, 29154192		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	12791994, 15107844, 16123373, 18984671, 19291425, 19924153, 20393693, 22577090, 24414038, 26253791, 26868433, 27793583, 28393700, 29025897		★☆☆☆☆ Found in Text Mining only
Diabetic Angiopathies	Diabetic cardiomyopathy	BEFREE	30618737		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	25447894, 28600485, 29025897		★☆☆☆☆ Found in Text Mining only
Diffuse Cerebral Sclerosis of Schilder	Schilder disease	Pubtator	29511103	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	30853360, 30988628		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	37285895, 37880674	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy	Epilepsy	BEFREE	31191318		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	31286822		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	33896816	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	27252525	Associate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	12791994, 19996382, 20461355		★☆☆☆☆ Found in Text Mining only
Hyperhomocysteinemia	Hyperhomocysteinemia	BEFREE	23349842		★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	27400471	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24414038, 28565784		★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	19389818	Associate	★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	Pubtator	23633196	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	21704407	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23185332	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	23558942	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	36555349	Inhibit	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	19389818, 21492415, 24414038, 25463099, 26253791, 34051802	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Kidney Diseases	Kidney Disease	BEFREE	28600485		★☆☆☆☆ Found in Text Mining only
Left Ventricular Hypertrophy	Left Ventricular Hypertrophy	BEFREE	28565784		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	20410507		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	32621919	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32621919	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	28486101, 33896816	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20410507		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	16123373, 29391905		★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	16123373		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	36555349	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35717579	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	21704407, 21864376, 23185332, 23319603, 23558942, 30678233, 30763339, 31844113		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	30853360, 30988628		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23632994, 28184934, 31562867		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27573078		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19904274, 23632994, 25168244, 26094770, 26517935, 26855171, 27573078, 27593927, 28393700, 28442401, 29520103, 31215104		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12743605, 21864376		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	17912026	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29929422		★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	29748013	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	26855171, 28790132		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	28790132	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	19389818	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	CTD_human_DG	18497449		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	19389818, 28476619, 28639842		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Mitochondrial Myopathies	Mitochondrial myopathy	Pubtator	35850946	Stimulate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	22250017		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	20410507		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	18436806		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12743605, 21821462, 21896644, 23319603, 23558942, 25168244, 26268733, 27573078, 27593927, 28442401, 28790132, 29109091, 29520103, 30365932, 31215104, 31448228		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	29386091, 31059759		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	29511103	Associate	★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	29289645		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	23632994		★☆☆☆☆ Found in Text Mining only
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	29289645		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Obesity	BEFREE	19389818, 21492415, 27207527, 28639842, 30071535, 31445205		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21492415	Associate	★☆☆☆☆ Found in Text Mining only
Obesity Abdominal	Obesity	Pubtator	19389818	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	19180501	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	35776529	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	31283965, 31849673		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	21492415		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	21492415	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	17912026	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28790132		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	28790132	Stimulate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	28790132		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30720074		★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary fibrosis	Pubtator	36555349	Inhibit	★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	30745845		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal detachment	Pubtator	35465829	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	33896816	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34580365	Associate	★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	38235126	Stimulate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	21821462		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27573078		★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	25603829		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30678233		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	38307969	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	26253791, 30006153	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	34051802	Associate	★☆☆☆☆ Found in Text Mining only
Ventricular hypertrophy	Ventricular hypertrophy	BEFREE	28565784		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

THEM4 5 shared pathwaysPIP3 activates AKT signaling, Negative regulation of the PI3K/AKT network, CD28 dependent PI3K/Akt signaling, VEGFR2 mediated vascular permeability, Activation of AKT2 Related via 5 shared pathways including PIP3 activates AKT signaling, Negative regulation of the PI3K/AKT network. SREBF1 2 shared pathwaysInsulin resistance, PPARA activates gene expression 4 shared evidence sourcesCTD (Diabetes mellitus type 2), Disgenet (Metabolic syndrome), CTD (Nonalcoholic fatty liver disease), Disgenet (Nonalcoholic fatty liver disease) Related via 2 shared pathways including Insulin resistance, PPARA activates gene expression — evidence mostly CTD. CPT1A 2 shared pathwaysInsulin resistance, PPARA activates gene expression 4 shared evidence sourcesCTD (Diabetes mellitus type 2), Disgenet (Metabolic syndrome), CTD (Nonalcoholic fatty liver disease), Disgenet (Nonalcoholic fatty liver disease) Related via 2 shared pathways including Insulin resistance, PPARA activates gene expression — evidence mostly CTD. INPPL1 3 shared evidence sourcesCTD (Diabetes mellitus type 2), Disgenet (Metabolic syndrome), CTD (Metabolic syndrome) Related via 3 shared evidence sources. RETN 1 shared diseasePromyelocytic leukemia 4 shared evidence sourcesCTD (Diabetes mellitus type 2), CTD (Promyelocytic leukemia), Disgenet (Metabolic syndrome), CTD (Metabolic syndrome) Related via 1 shared disease including Promyelocytic leukemia — evidence mostly CTD.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
THEM4	0	[]	5	["PIP3 activates AKT signaling","Negative regulation of the PI3K\/AKT network","CD28 dependent PI3K\/Akt signaling","VEGFR2 mediated vascular permeability","Activation of AKT2"]	0	[]
SREBF1	0	[]	2	["Insulin resistance","PPARA activates gene expression"]	4	["CTD (Diabetes mellitus type 2)","Disgenet (Metabolic syndrome)","CTD (Nonalcoholic fatty liver disease)","Disgenet (Nonalcoholic fatty liver disease)"]
CPT1A	0	[]	2	["Insulin resistance","PPARA activates gene expression"]	4	["CTD (Diabetes mellitus type 2)","Disgenet (Metabolic syndrome)","CTD (Nonalcoholic fatty liver disease)","Disgenet (Nonalcoholic fatty liver disease)"]
INPPL1	0	[]	0	[]	3	["CTD (Diabetes mellitus type 2)","Disgenet (Metabolic syndrome)","CTD (Metabolic syndrome)"]
RETN	1	["Promyelocytic leukemia"]	0	[]	4	["CTD (Diabetes mellitus type 2)","CTD (Promyelocytic leukemia)","Disgenet (Metabolic syndrome)","CTD (Metabolic syndrome)"]

Diseases Linked via Similar Genes

Obesity Linked via 4 of 5 related genesSREBF1, CPT1A, INPPL1, RETN Kidney failure Linked via 3 of 5 related genesSREBF1, CPT1A, RETN Hepatocellular carcinoma Linked via 2 of 5 related genesTHEM4, SREBF1 Hypertension Linked via 2 of 5 related genesINPPL1, RETN Atrial fibrillation Linked via 1 of 5 related genesTHEM4

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Obesity	4	["SREBF1","CPT1A","INPPL1","RETN"]
Kidney failure	3	["SREBF1","CPT1A","RETN"]
Hepatocellular carcinoma	2	["THEM4","SREBF1"]
Hypertension	2	["INPPL1","RETN"]
Atrial fibrillation	1	["THEM4"]