Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs Transcription factors Other IDs Associated diseases
Entrez ID	6720
Gene name	Sterol regulatory element binding transcription factor 1
Gene symbol	SREBF1
Synonyms (NCBI Gene)	HMDIFAP2SREBP1bHLHd1
Chromosome	17
Chromosome location	17p11.2
Summary	This gene encodes a basic helix-loop-helix-leucine zipper (bHLH-Zip) transcription factor that binds to the sterol regulatory element-1 (SRE1), which is a motif that is found in the promoter of the low density lipoprotein receptor gene and other genes inv

333

Show/Hide all (333)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018325	hsa-miR-335-5p	Microarray	18185580
MIRT051418	hsa-let-7e-5p	CLASH	23622248
MIRT050226	hsa-miR-25-3p	CLASH	23622248
MIRT047574	hsa-miR-10a-5p	CLASH	23622248
MIRT045315	hsa-miR-185-5p	CLASH	23622248
MIRT043859	hsa-miR-378a-3p	CLASH	23622248
MIRT041670	hsa-miR-484	CLASH	23622248
MIRT038739	hsa-miR-93-3p	CLASH	23622248
MIRT037474	hsa-miR-744-5p	CLASH	23622248
MIRT054225	hsa-miR-128-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23990020
MIRT054225	hsa-miR-128-3p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	23990020
MIRT054666	hsa-miR-33a-5p	qRT-PCRWestern blot	24300912
MIRT045315	hsa-miR-185-5p	Luciferase reporter assayqRT-PCRWestern blot	23951060
MIRT438066	hsa-miR-342-3p	Luciferase reporter assayqRT-PCRWestern blot	23951060
MIRT045315	hsa-miR-185-5p	Luciferase reporter assayqRT-PCRWestern blot	23951060
MIRT438066	hsa-miR-342-3p	Luciferase reporter assayqRT-PCRWestern blot	23951060
MIRT721601	hsa-miR-495-3p	HITS-CLIP	19536157
MIRT721600	hsa-miR-5688	HITS-CLIP	19536157
MIRT721599	hsa-miR-7-1-3p	HITS-CLIP	19536157
MIRT721598	hsa-miR-7-2-3p	HITS-CLIP	19536157
MIRT721597	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT721597	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT721596	hsa-miR-4301	HITS-CLIP	19536157
MIRT721595	hsa-miR-4286	HITS-CLIP	19536157
MIRT721594	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT721593	hsa-miR-4290	HITS-CLIP	19536157
MIRT721592	hsa-miR-3156-3p	HITS-CLIP	19536157
MIRT721591	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT487335	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	20371350
MIRT487333	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT487329	hsa-miR-4271	PAR-CLIP	20371350
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT487326	hsa-miR-663b	PAR-CLIP	20371350
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	20371350
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT487335	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	20371350
MIRT487333	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT487329	hsa-miR-4271	PAR-CLIP	20371350
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT487326	hsa-miR-663b	PAR-CLIP	20371350
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	20371350
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT487335	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	20371350
MIRT487333	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT487329	hsa-miR-4271	PAR-CLIP	20371350
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT487326	hsa-miR-663b	PAR-CLIP	20371350
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	20371350
MIRT527532	hsa-miR-95-5p	PAR-CLIP	22012620
MIRT527531	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT487335	hsa-miR-671-5p	PAR-CLIP	23592263
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	23592263
MIRT487333	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT487329	hsa-miR-4271	PAR-CLIP	23592263
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT487326	hsa-miR-663b	PAR-CLIP	23592263
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	23592263
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	23592263
MIRT439142	hsa-let-7c-5p	3'LIFE	25074381
MIRT439117	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439142	hsa-let-7c-5p	3'LIFE	25074381
MIRT439117	hsa-miR-10b-5p	3'LIFE	25074381
MIRT721601	hsa-miR-495-3p	HITS-CLIP	19536157
MIRT721600	hsa-miR-5688	HITS-CLIP	19536157
MIRT721599	hsa-miR-7-1-3p	HITS-CLIP	19536157
MIRT721598	hsa-miR-7-2-3p	HITS-CLIP	19536157
MIRT721597	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT721597	hsa-miR-483-3p	HITS-CLIP	19536157
MIRT721596	hsa-miR-4301	HITS-CLIP	19536157
MIRT721595	hsa-miR-4286	HITS-CLIP	19536157
MIRT721594	hsa-miR-532-3p	HITS-CLIP	19536157
MIRT721593	hsa-miR-4290	HITS-CLIP	19536157
MIRT721592	hsa-miR-3156-3p	HITS-CLIP	19536157
MIRT721591	hsa-miR-6749-3p	HITS-CLIP	19536157
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT487335	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	20371350
MIRT487333	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT487329	hsa-miR-4271	PAR-CLIP	20371350
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT487326	hsa-miR-663b	PAR-CLIP	20371350
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	20371350
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT487335	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	20371350
MIRT487333	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT487329	hsa-miR-4271	PAR-CLIP	20371350
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT487326	hsa-miR-663b	PAR-CLIP	20371350
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	20371350
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	20371350
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	20371350
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	20371350
MIRT487335	hsa-miR-671-5p	PAR-CLIP	20371350
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	20371350
MIRT487333	hsa-miR-149-3p	PAR-CLIP	20371350
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	20371350
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	20371350
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	20371350
MIRT487329	hsa-miR-4271	PAR-CLIP	20371350
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	20371350
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	20371350
MIRT487326	hsa-miR-663b	PAR-CLIP	20371350
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	20371350
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	20371350
MIRT527532	hsa-miR-95-5p	PAR-CLIP	22012620
MIRT527531	hsa-miR-4668-5p	PAR-CLIP	22012620
MIRT487338	hsa-miR-6783-5p	PAR-CLIP	23592263
MIRT487337	hsa-miR-4716-3p	PAR-CLIP	23592263
MIRT487336	hsa-miR-6794-5p	PAR-CLIP	23592263
MIRT487335	hsa-miR-671-5p	PAR-CLIP	23592263
MIRT487334	hsa-miR-4743-5p	PAR-CLIP	23592263
MIRT487333	hsa-miR-149-3p	PAR-CLIP	23592263
MIRT487332	hsa-miR-4728-5p	PAR-CLIP	23592263
MIRT487331	hsa-miR-6785-5p	PAR-CLIP	23592263
MIRT487330	hsa-miR-6883-5p	PAR-CLIP	23592263
MIRT487329	hsa-miR-4271	PAR-CLIP	23592263
MIRT487327	hsa-miR-4725-3p	PAR-CLIP	23592263
MIRT487328	hsa-miR-6780b-5p	PAR-CLIP	23592263
MIRT487326	hsa-miR-663b	PAR-CLIP	23592263
MIRT487325	hsa-miR-7108-5p	PAR-CLIP	23592263
MIRT487324	hsa-miR-4474-3p	PAR-CLIP	23592263
MIRT1387947	hsa-miR-1323	CLIP-seq
MIRT1387948	hsa-miR-142-5p	CLIP-seq
MIRT1387949	hsa-miR-18a	CLIP-seq
MIRT1387950	hsa-miR-18b	CLIP-seq
MIRT1387951	hsa-miR-296-5p	CLIP-seq
MIRT1387952	hsa-miR-3148	CLIP-seq
MIRT1387953	hsa-miR-3173-3p	CLIP-seq
MIRT1387954	hsa-miR-3647-3p	CLIP-seq
MIRT1387955	hsa-miR-4459	CLIP-seq
MIRT1387956	hsa-miR-4698	CLIP-seq
MIRT1387957	hsa-miR-4735-3p	CLIP-seq
MIRT1387958	hsa-miR-4779	CLIP-seq
MIRT1387959	hsa-miR-513c	CLIP-seq
MIRT1387960	hsa-miR-514b-5p	CLIP-seq
MIRT1387961	hsa-miR-548o	CLIP-seq
MIRT1387962	hsa-miR-561	CLIP-seq
MIRT1387963	hsa-miR-1234	CLIP-seq
MIRT1387964	hsa-miR-1275	CLIP-seq
MIRT1387965	hsa-miR-1286	CLIP-seq
MIRT1387947	hsa-miR-1323	CLIP-seq
MIRT1387948	hsa-miR-142-5p	CLIP-seq
MIRT1387949	hsa-miR-18a	CLIP-seq
MIRT1387950	hsa-miR-18b	CLIP-seq
MIRT1387966	hsa-miR-1910	CLIP-seq
MIRT1387967	hsa-miR-2467-3p	CLIP-seq
MIRT1387968	hsa-miR-3158-5p	CLIP-seq
MIRT1387953	hsa-miR-3173-3p	CLIP-seq
MIRT1387969	hsa-miR-330-3p	CLIP-seq
MIRT1387970	hsa-miR-3612	CLIP-seq
MIRT1387954	hsa-miR-3647-3p	CLIP-seq
MIRT1387971	hsa-miR-3678-3p	CLIP-seq
MIRT1387972	hsa-miR-3690	CLIP-seq
MIRT1387973	hsa-miR-377	CLIP-seq
MIRT1387974	hsa-miR-3973	CLIP-seq
MIRT1387975	hsa-miR-4254	CLIP-seq
MIRT1387976	hsa-miR-4297	CLIP-seq
MIRT1387977	hsa-miR-4325	CLIP-seq
MIRT1387978	hsa-miR-4436a	CLIP-seq
MIRT1387979	hsa-miR-4443	CLIP-seq
MIRT1387980	hsa-miR-4446-5p	CLIP-seq
MIRT1387981	hsa-miR-450b-5p	CLIP-seq
MIRT1387982	hsa-miR-4525	CLIP-seq
MIRT1387983	hsa-miR-455-3p	CLIP-seq
MIRT1387984	hsa-miR-4665-3p	CLIP-seq
MIRT1387985	hsa-miR-4665-5p	CLIP-seq
MIRT1387986	hsa-miR-4723-5p	CLIP-seq
MIRT1387987	hsa-miR-4731-5p	CLIP-seq
MIRT1387957	hsa-miR-4735-3p	CLIP-seq
MIRT1387988	hsa-miR-4755-5p	CLIP-seq
MIRT1387989	hsa-miR-4763-5p	CLIP-seq
MIRT1387958	hsa-miR-4779	CLIP-seq
MIRT1387959	hsa-miR-513c	CLIP-seq
MIRT1387960	hsa-miR-514b-5p	CLIP-seq
MIRT1387990	hsa-miR-518a-5p	CLIP-seq
MIRT1387991	hsa-miR-527	CLIP-seq
MIRT1387992	hsa-miR-548an	CLIP-seq
MIRT1387961	hsa-miR-548o	CLIP-seq
MIRT1387993	hsa-miR-550a	CLIP-seq
MIRT1387962	hsa-miR-561	CLIP-seq
MIRT1387994	hsa-miR-625	CLIP-seq
MIRT1387995	hsa-miR-637	CLIP-seq
MIRT1387996	hsa-miR-650	CLIP-seq
MIRT1387963	hsa-miR-1234	CLIP-seq
MIRT1387969	hsa-miR-330-3p	CLIP-seq
MIRT1387976	hsa-miR-4297	CLIP-seq
MIRT1387984	hsa-miR-4665-3p	CLIP-seq
MIRT2116230	hsa-miR-1233	CLIP-seq
MIRT2116231	hsa-miR-150	CLIP-seq
MIRT2116232	hsa-miR-185	CLIP-seq
MIRT2116233	hsa-miR-3065-3p	CLIP-seq
MIRT2116234	hsa-miR-3153	CLIP-seq
MIRT2116235	hsa-miR-326	CLIP-seq
MIRT2116236	hsa-miR-330-5p	CLIP-seq
MIRT1387970	hsa-miR-3612	CLIP-seq
MIRT2116237	hsa-miR-4306	CLIP-seq
MIRT1387979	hsa-miR-4443	CLIP-seq
MIRT2116238	hsa-miR-4487	CLIP-seq
MIRT2116239	hsa-miR-4497	CLIP-seq
MIRT2116240	hsa-miR-4644	CLIP-seq
MIRT2116241	hsa-miR-4667-5p	CLIP-seq
MIRT2116242	hsa-miR-4695-5p	CLIP-seq
MIRT2116243	hsa-miR-4700-5p	CLIP-seq
MIRT2116244	hsa-miR-4713-5p	CLIP-seq
MIRT2116245	hsa-miR-4757-5p	CLIP-seq
MIRT2116246	hsa-miR-486-3p	CLIP-seq
MIRT1387995	hsa-miR-637	CLIP-seq
MIRT1387996	hsa-miR-650	CLIP-seq
MIRT2116247	hsa-miR-662	CLIP-seq
MIRT2338765	hsa-miR-1236	CLIP-seq
MIRT1387947	hsa-miR-1323	CLIP-seq
MIRT2116233	hsa-miR-3065-3p	CLIP-seq
MIRT2338766	hsa-miR-3137	CLIP-seq
MIRT1387952	hsa-miR-3148	CLIP-seq
MIRT2338767	hsa-miR-3183	CLIP-seq
MIRT2338768	hsa-miR-339-5p	CLIP-seq
MIRT2338769	hsa-miR-4257	CLIP-seq
MIRT1387976	hsa-miR-4297	CLIP-seq
MIRT2338770	hsa-miR-4421	CLIP-seq
MIRT1387955	hsa-miR-4459	CLIP-seq
MIRT2338771	hsa-miR-4672	CLIP-seq
MIRT2338772	hsa-miR-4723-3p	CLIP-seq
MIRT2338773	hsa-miR-486-5p	CLIP-seq
MIRT1387959	hsa-miR-513c	CLIP-seq
MIRT1387960	hsa-miR-514b-5p	CLIP-seq
MIRT1387961	hsa-miR-548o	CLIP-seq
MIRT2338774	hsa-miR-670	CLIP-seq
MIRT2395152	hsa-miR-4649-3p	CLIP-seq
MIRT2116230	hsa-miR-1233	CLIP-seq
MIRT1387963	hsa-miR-1234	CLIP-seq
MIRT2632205	hsa-miR-1289	CLIP-seq
MIRT2116231	hsa-miR-150	CLIP-seq
MIRT2116232	hsa-miR-185	CLIP-seq
MIRT2116234	hsa-miR-3153	CLIP-seq
MIRT2632206	hsa-miR-3173-5p	CLIP-seq
MIRT2632207	hsa-miR-3198	CLIP-seq
MIRT2116235	hsa-miR-326	CLIP-seq
MIRT2116236	hsa-miR-330-5p	CLIP-seq
MIRT2632208	hsa-miR-4270	CLIP-seq
MIRT2632209	hsa-miR-4294	CLIP-seq
MIRT2116237	hsa-miR-4306	CLIP-seq
MIRT2632210	hsa-miR-4309	CLIP-seq
MIRT2632211	hsa-miR-4327	CLIP-seq
MIRT2632212	hsa-miR-4441	CLIP-seq
MIRT2632213	hsa-miR-4480	CLIP-seq
MIRT2116239	hsa-miR-4497	CLIP-seq
MIRT2116240	hsa-miR-4644	CLIP-seq
MIRT2116241	hsa-miR-4667-5p	CLIP-seq
MIRT2116243	hsa-miR-4700-5p	CLIP-seq
MIRT2632214	hsa-miR-4704-5p	CLIP-seq
MIRT2116244	hsa-miR-4713-5p	CLIP-seq
MIRT2632215	hsa-miR-4715-5p	CLIP-seq
MIRT2116245	hsa-miR-4757-5p	CLIP-seq
MIRT2632216	hsa-miR-4785	CLIP-seq
MIRT2116246	hsa-miR-486-3p	CLIP-seq
MIRT1387995	hsa-miR-637	CLIP-seq
MIRT2116247	hsa-miR-662	CLIP-seq
MIRT2116230	hsa-miR-1233	CLIP-seq
MIRT1387963	hsa-miR-1234	CLIP-seq
MIRT2632205	hsa-miR-1289	CLIP-seq
MIRT2116231	hsa-miR-150	CLIP-seq
MIRT2116232	hsa-miR-185	CLIP-seq
MIRT2116234	hsa-miR-3153	CLIP-seq
MIRT2632206	hsa-miR-3173-5p	CLIP-seq
MIRT2632207	hsa-miR-3198	CLIP-seq
MIRT2116235	hsa-miR-326	CLIP-seq
MIRT2116236	hsa-miR-330-5p	CLIP-seq
MIRT2632208	hsa-miR-4270	CLIP-seq
MIRT2632209	hsa-miR-4294	CLIP-seq
MIRT2116237	hsa-miR-4306	CLIP-seq
MIRT2632210	hsa-miR-4309	CLIP-seq
MIRT2632211	hsa-miR-4327	CLIP-seq
MIRT2632212	hsa-miR-4441	CLIP-seq
MIRT2632213	hsa-miR-4480	CLIP-seq
MIRT2116239	hsa-miR-4497	CLIP-seq
MIRT2116240	hsa-miR-4644	CLIP-seq
MIRT2116241	hsa-miR-4667-5p	CLIP-seq
MIRT2116243	hsa-miR-4700-5p	CLIP-seq
MIRT2632214	hsa-miR-4704-5p	CLIP-seq
MIRT2116244	hsa-miR-4713-5p	CLIP-seq
MIRT2632215	hsa-miR-4715-5p	CLIP-seq
MIRT2116245	hsa-miR-4757-5p	CLIP-seq
MIRT2632216	hsa-miR-4785	CLIP-seq
MIRT2116246	hsa-miR-486-3p	CLIP-seq
MIRT1387995	hsa-miR-637	CLIP-seq
MIRT2116247	hsa-miR-662	CLIP-seq

Show/Hide all (2)

Transcription factor	Regulation	Reference
SP1	Activation	20179320
SP1	Unknown	15462672

108

Show/Hide all (108)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000139	Component	Golgi membrane	IEA
GO:0000139	Component	Golgi membrane	TAS
GO:0000785	Component	Chromatin	ISA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IDA	23610160
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IDA	12177166, 32322062
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IMP	32497488
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001221	Function	Transcription coregulator binding	IPI	14701856
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IDA	24296663, 31501273
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0003062	Process	Regulation of heart rate by chemical signal	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IDA	16407292
GO:0004879	Function	Nuclear receptor activity	IDA	23610160
GO:0005515	Function	Protein binding	IPI	16713569, 16799563, 18385733, 20817729, 21993218, 23610160, 32814053
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12202038, 15358760, 32322062
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	IMP	32497488
GO:0005634	Component	Nucleus	TAS	8156598
GO:0005635	Component	Nuclear envelope	TAS	8156598
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	ISS
GO:0005783	Component	Endoplasmic reticulum	IDA	12202038
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	TAS	8156598
GO:0005794	Component	Golgi apparatus	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IDA	32322062
GO:0006357	Process	Regulation of transcription by RNA polymerase II	TAS	8156598
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006629	Process	Lipid metabolic process	TAS	8156598
GO:0006695	Process	Cholesterol biosynthetic process	IEA
GO:0007584	Process	Response to nutrient	IEA
GO:0007623	Process	Circadian rhythm	IEA
GO:0008202	Process	Steroid metabolic process	IEA
GO:0008203	Process	Cholesterol metabolic process	IEA
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0008610	Process	Lipid biosynthetic process	IEA
GO:0008610	Process	Lipid biosynthetic process	IMP	32497488
GO:0008610	Process	Lipid biosynthetic process	ISS
GO:0009267	Process	Cellular response to starvation	IEA
GO:0009267	Process	Cellular response to starvation	ISS	16407292
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009749	Process	Response to glucose	IEA
GO:0009750	Process	Response to fructose	IEA
GO:0010867	Process	Positive regulation of triglyceride biosynthetic process	IEA
GO:0010867	Process	Positive regulation of triglyceride biosynthetic process	ISS
GO:0012507	Component	ER to Golgi transport vesicle membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0019217	Process	Regulation of fatty acid metabolic process	IEA
GO:0019901	Function	Protein kinase binding	IEA
GO:0030073	Process	Insulin secretion	IEA
GO:0030324	Process	Lung development	IEA
GO:0030522	Process	Intracellular receptor signaling pathway	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0031647	Process	Regulation of protein stability	IMP	24912190
GO:0032094	Process	Response to food	IEA
GO:0032526	Process	Response to retinoic acid	IEA
GO:0032570	Process	Response to progesterone	IEA
GO:0032810	Function	Sterol response element binding	IDA	16407292, 31501273
GO:0032869	Process	Cellular response to insulin stimulus	IEA
GO:0032933	Process	SREBP signaling pathway	IDA	27614840, 32322062
GO:0032933	Process	SREBP signaling pathway	IEA
GO:0032933	Process	SREBP signaling pathway	IMP	27614840
GO:0032991	Component	Protein-containing complex	IEA
GO:0033762	Process	Response to glucagon	IEA
GO:0033993	Process	Response to lipid	IEA
GO:0042789	Process	MRNA transcription by RNA polymerase II	IEA
GO:0043434	Process	Response to peptide hormone	IEA
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IDA	12177166, 32322062
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IEA
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IEA
GO:0045542	Process	Positive regulation of cholesterol biosynthetic process	IMP	12177166
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IDA	12242332, 26437365, 31501273
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IGI	23610160
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	TAS	23610160
GO:0046676	Process	Negative regulation of insulin secretion	IEA
GO:0046983	Function	Protein dimerization activity	IEA
GO:0050796	Process	Regulation of insulin secretion	IEA
GO:0051591	Process	Response to cAMP	IEA
GO:0070542	Process	Response to fatty acid	IEA
GO:0071398	Process	Cellular response to fatty acid	IEA
GO:0090209	Process	Negative regulation of triglyceride metabolic process	IDA	28483554
GO:1901524	Process	Regulation of mitophagy	IMP	24912190
GO:1902895	Process	Positive regulation of miRNA transcription	IDA	24296663, 31501273
GO:1903214	Process	Regulation of protein targeting to mitochondrion	IMP	24912190
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536

MIM	HGNC	e!Ensembl
184756	11289	ENSG00000072310

P36956

Protein name

Sterol regulatory element-binding protein 1 (SREBP-1) (Class D basic helix-loop-helix protein 1) (bHLHd1) (Sterol regulatory element-binding transcription factor 1) [Cleaved into: Processed sterol regulatory element-binding protein 1 (Transcription factor

Protein function

[Sterol regulatory element-binding protein 1]: Precursor of the transcription factor form (Processed sterol regulatory element-binding protein 1), which is embedded in the endoplasmic reticulum membrane (PubMed:32322062). Low sterol concentratio

PDB

1AM9

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00010	HLH	324 → 374	Helix-loop-helix DNA-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in a wide variety of tissues, most abundant in liver and adrenal gland (PubMed:8402897). In fetal tissues lung and liver shows highest expression (PubMed:8402897). {ECO:0000269|PubMed:8402897}.; TISSUE SPECIFICITY: [Isoform S

Sequence

MDEPPFSEAALEQALGEPCDLDAALLTDIEDMLQLINNQDSDFPGLFDPPYAGSGAGGTD
PASPDTSSPGSLSPPPATLSSSLEAFLSGPQAAPSPLSPPQPAPTPLKMYPSMPAFSPGP
GIKEESVPLSILQTPTPQPLPGALLPQSFPAPAPPQFSSTPVLGYPSPPGGFSTGSPPGN
TQQPLPGLPLASPPGVPPVSLHTQVQSVVPQQLLTVTAAPTAAPVTTTVTSQIQQVPVLL
QPHFIKADSLLLTAMKTDGATVKAAGLSPLVSGTTVQTGPLPTLVSGGTILATVPLVVDA
EKLPINRLAAGSKAPASAQSRGEKRTAHNAIEKRYRSSINDKIIELKDLVVGTEAKLNKS
AVLRKAIDYIRFLQHSNQKLKQENLSLRTAVHKSKSLKDLVSACGSGGNTDVLMEGVKTE
VEDTLTPPPSDAGSPFQSSPLSLGSRGSGSGGSGSDSEPDSPVFEDSKAKPEQRPSLHSR
GMLDRSRLALCTLVFLCLSCNPLASLLGARGLPSPSDTTSVYHSPGRNVLGTESRDGPGW
AQWLLPPVVWLLNGLLVLVSLVLLFVYGEPVTRPHSGPAVYFWRHRKQADLDLARGDFAQ
AAQQLWLALRALGRPLPTSHLDLACSLLWNLIRHLLQRLWVGRWLAGRAGGLQQDCALRV
DASASARDAALVYHKLHQLHTMGKHTGGHLTATNLALSALNLAECAGDAVSVATLAEIYV
AAALRVKTSLPRALHFLTRFFLSSARQACLAQSGSVPPAMQWLCHPVGHRFFVDGDWSVL
STPWESLYSLAGNPVDPLAQVTQLFREHLLERALNCVTQPNPSPGSADGDKEFSDALGYL
QLLNSCSDAAGAPAYSFSISSSMATTTGVDPVAKWWASLTAVVIHWLRRDEEAAERLCPL
VEHLPRVLQESERPLPRAALHSFKAARALLGCAKAESGPASLTICEKASGYLQDSLATTP
ASSSIDKAVQLFLCDLLLVVRTSLWRQQQPPAPAPAAQGTSSRPQASALELRGFQRDLSS
LRRLAQSFRPAMRRVFLHEATARLMAGASPTRTHQLLDRSLRRRAGPGGKGGAVAELEPR
PTRREHAEALLLASCYLPPGFLSAPGQRVGMLAEAARTLEKLGDRRLLHDCQQMLMRLGG
GTTVTSS

Sequence length

1147

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hereditary mucoepithelial dysplasia	Likely pathogenic; Pathogenic	rs1045239575, rs2033690347, rs1428621525	RCV003990155 RCV001260974 RCV001260975	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
IFAP syndrome 1, with or without BRESHECK syndrome	Pathogenic	rs2033690347, rs2033689385, rs2033688284	RCV001263099 RCV001263100 RCV001263101	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
IFAP syndrome 2	Pathogenic	rs2033690347, rs2033689385, rs2033688284	RCV001255643 RCV001255644 RCV001255645	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (35)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC ISCHEMIC HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERIOSCLEROSIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY HEART DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, NON-INSULIN-DEPENDENT	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FATTY LIVER, ALCOHOLIC	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GALLSTONES	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HIRSCHSPRUNG DISEASE	—	ClinGen, Disgenet, Orphanet ClinGen, Disgenet, Orphanet ClinGen, Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IGA GLOMERULONEPHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSULIN RESISTANCE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY FAILURE, CHRONIC	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC DISEASES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MUCOEPITHELIAL DYSPLASIA, HEREDITARY	—	HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NONALCOHOLIC STEATOHEPATITIS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Obesity	Conflicting classifications of pathogenicity	ClinVar CTD, Disgenet CTD, Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Ovarian serous cystadenocarcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SREBF1-related disorder	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URBAN SCHOSSER SPOHN SYNDROME	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (195)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acne	Acne	BEFREE	30972839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acne Vulgaris	Acne	BEFREE	30972839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	31299935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	21871872		★★★★★ ★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	28521289		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	15026365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21546605, 24655714, 30354203, 30863480, 31610782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	19292868, 23717417, 31610782, 40527779	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21546605, 24655714, 30354203, 30863480, 31610782		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrophy	Atrophy	Pubtator	23226416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Azoospermia Nonobstructive	Nonobstructive azoospermia	Pubtator	24842676	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19252981, 25880005, 29988076, 30180878, 30625181, 31073170		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23082122, 31073170, 34575972, 36960852	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36087034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20173757, 24776759, 34311471, 34981667, 37828054	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	27939887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	36512324	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	28521289	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33647481, 34285190, 36694250	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	23818099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	23680128, 35652342	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	31610782	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	28719803		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	26873854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31299935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	31299935	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29556313, 31299935, 31601152		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	16817902, 31299935, 31601152, 36348128	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Hyperinsulinism	Congenital hyperinsulinism	Pubtator	20699619	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	29183723, 30446222		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	21036322, 28095459, 28367087		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	LHGDN	12752570		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	BEFREE	21036322, 28095459, 28367087, 29152152, 31610782		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	28095459, 28367087, 36380121, 39614436	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	31610782	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	Pubtator	32323776	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Disease	Coronary artery disease	Pubtator	23840567, 39953634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	21036322, 23840567, 28095459, 28367087		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Degenerative polyarthritis	Arthritis	BEFREE	29976400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dementia	Dementia	BEFREE	20167577		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dementia	Dementia	Pubtator	20167577	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Depressive disorder	Mental Depression	BEFREE	30088470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	15677507, 17160088, 23603006, 23880101, 24614076, 28367087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	38326276	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	15677507, 17160088, 20032468, 23603006, 23880101, 24614076, 26112216, 28367087		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	17019602, 18654640, 26095709, 28521289, 31169416, 36529747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	14742839, 17019602, 19292868, 19720801, 24614076, 26095709, 27148772, 30600310, 31169416, 31506343, 32041280, 32710190, 36529747	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	17030965, 18448614	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Ketosis-Prone	Diabetes Mellitus	BEFREE	19062325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	11916923, 15277400, 16005884, 16429400, 17160088, 18192539, 19062325, 22325160, 24614076, 25758573, 26095709, 26823690, 27148772, 28367087, 31169416		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	22325160		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	29420703, 29469229, 30348828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	15277400, 21546605, 31299935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	LHGDN	15277400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	19913854, 27301461, 35899893	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	31299935	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	30180878	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	22672904, 24614076, 25270091, 28176325, 28356952, 30206735, 30452972		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	22672904, 24105476, 24614076, 34039951, 37305395	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	24614076, 28176325	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial Neoplasms	BEFREE	25270091		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epidermodysplasia Verruciformis	Epidermodysplasia Verruciformis	BEFREE	29371918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial partial lipodystrophy	Partial Lipodystrophy	BEFREE	11929849, 21993218, 25524705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	14633850, 17484888, 18627005, 20200319, 21105651, 21757781, 24300912, 25087956, 28449683, 28483554, 28557705, 29140550, 30356113		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	LHGDN	15809359, 18360697		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	19733654, 23103837, 24603540, 32332706, 35152538, 37385614	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty Liver	CTD_human_DG	24469900		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver	Fatty liver	Pubtator	25406988, 33096687	Stimulate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fatty Liver Disease	Fatty Liver	BEFREE	23603006, 30078674, 31500354		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver, Alcoholic	Alcoholic Fatty Liver	BEFREE	24456360		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrosis, Liver	Liver Fibrosis	BEFREE	29548749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	31762191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22059152, 22586629, 27477273, 28483521, 29159775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22059152, 22586629, 27477273, 28483521, 29159775		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	24077277, 35894143	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	35769467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hearing Loss	Hearing loss	Pubtator	26095709	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	24478438, 27193023	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatocellular Adenoma	Hepatocellular adenoma	BEFREE	17379603		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	BEFREE	16005884, 18095312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	24825092, 30649892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	11916923, 22471940, 23315940, 31216433		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	22471940, 27301461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	21546605, 31226525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemias	Hyperlipidemia	Pubtator	27777315	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type II	Hyperlipoproteinemia	Pubtator	33028190	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	LHGDN	15809359		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertriglyceridemia	Hypertriglyceridemia	Pubtator	27301461	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypocholesterolemia	Hypocholesterolemia	BEFREE	28322010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoglycemia	Hypoglycemia	BEFREE	14633850		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoinsulinaemia (disorder)	Hypoinsulinemia	BEFREE	30978208		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypothyroidism	Hypothyroidism	BEFREE	30707786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	26873854		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	35769467	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	18654640, 19733654, 19913854, 21701566, 35417665	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Iron Overload	Iron overload	Pubtator	21114893	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ketosis	Ketosis	BEFREE	19062325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure	Kidney Failure	BEFREE	17198935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	CTD_human_DG	19878707		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lipid Metabolism Disorders	Lipid Metabolism Disorders	BEFREE	30265925, 30336314		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipoatrophy	Lipoatrophy	BEFREE	11937183		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	BEFREE	11937183, 22103520		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy	Lipodystrophy	Pubtator	21993218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lipodystrophy Familial Partial	Lipodystrophy	Pubtator	21993218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	16940799, 21355074		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	14563831, 21147110		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	19008011, 21147110, 21757781, 24776759, 28604762, 29702135, 30004626, 31297058, 31409773, 31511501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	19008011		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	24152445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	24152445	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	21757781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	35806291	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	36087034	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	24776759, 34799559	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31887541, 36171622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19252981, 25880005, 29988076, 30180878, 30625181, 31073170		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	22672904, 24614076, 25270091, 28176325, 28356952, 30206735		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gallbladder	Gallbladder cancer	BEFREE	31762191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	27939887		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	23818099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25589463, 28483521, 31296258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15026365, 18774944, 22064655, 22540830, 23951060, 28483521, 29466694, 29784665, 30301150, 31772672		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	11064454, 16982739, 25589463, 25880005, 27477273, 28483521, 29059153, 29449559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31299935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12531699		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	18281474		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29950559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	30970006, 31316083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30088470		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	15277400, 30057115		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic Diseases	LHGDN	15277400		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Diseases	Metabolic syndrome	Pubtator	22848045, 33978191, 34526523, 35843982	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Metabolic Syndrome	Metabolic syndrome	Pubtator	26771965, 27301461, 28095459, 34780523, 39294274, 40243421	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	24121055, 26982812, 29115033, 29147905, 30581395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microvascular Angina	Microvascular Angina	BEFREE	12079831, 15102555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34378191	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	39953634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy, Emery-Dreifuss	Emery-Dreifuss Muscular Dystrophy	BEFREE	11929849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myotonic Dystrophy	Myotonic dystrophy	Pubtator	30845774	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29968360		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	34546840, 35628510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15026365, 18281474, 22059152, 22672904, 23818099, 24776759, 25589463, 26555173, 28342983, 28356952, 29059153, 29663480, 29784665, 31296258, 31379107, 31511501 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30569418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	23603006, 25634759, 28483554, 28777914, 30165848, 31063640, 31409773, 31500354		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	CTD_human_DG	23603006, 24633463		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	BEFREE	23603006		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonalcoholic Steatohepatitis	Non-alcoholic Fatty Liver Disease	CTD_human_DG	23603006, 24633463		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	23208501		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	CTD_human_DG	10900012		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Obesity	Obesity	Pubtator	11707537, 15833942, 17030965, 19292868, 19733654, 24614076, 27467133, 30422702, 35417665, 36529747, 37106328, 37385614	Associate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Obesity	Obesity	BEFREE	15277400, 16005884, 24300912, 24614076, 28333398, 29615982, 30422702		★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Obesity	Obesity	Pubtator	19913854, 30845774, 34526523	Stimulate	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Osteoarthritis	Osteoarthritis	Pubtator	34899727	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	31736227		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	31736227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	23818099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25589463, 28483521, 31296258		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	24091913		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	Pubtator	15833942	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	21738487, 24912190, 29128630, 30231795		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	GWASDB_DG	21738487		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	GWASCAT_DG	21738487		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	21738487, 24514572	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Partial lipodystrophy	Partial Lipodystrophy	BEFREE	11929849		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	28083517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	22311022, 28176325		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	28176325, 31618328	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	37445796, 39294274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Presenile dementia	Senile Dementia	BEFREE	20167577		★★★★★ ★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	21993218		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15026365, 18774944, 22064655, 22540830, 23951060, 28483521, 29466694, 29784665, 30301150		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	15026365, 18774944		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18774944, 20025723, 22540830, 25294820, 29784665, 31395683, 32258129, 33471067, 33780364, 34948018, 38279172	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	30626759		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	24077277		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18936756, 24329191, 26873854, 26982812, 27492885, 29720671		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18936756		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	24329191, 25433960	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sitosterolemia	Sitosterolemia	BEFREE	9610773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sitosterolemia	Sitosterolemia	Pubtator	9610773	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	30600310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	30476296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sleep Deprivation	Sleep deprivation	Pubtator	25197809	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Smith-Magenis syndrome	Smith-Magenis Syndrome	BEFREE	12180145, 29077507		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	37090107	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	17379603, 17484888, 18627005, 20196803, 20200319, 21105651, 21757781, 24300912, 25087956, 25182422, 28449683, 28483554, 28557705, 29140550, 30356113, 31824338 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	CTD_human_DG	24469900		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32464305, 36171622	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	28360860		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	31887541, 38436206	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tremor	Tremor	Pubtator	24514572	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	22311022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichothiodystrophy Syndromes	Trichothiodystrophy	BEFREE	23221806		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34116604, 35685866, 37542643	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

SREBF1 (sterol regulatory element binding transcription factor 1)