TRAPPC5 (trafficking protein particle complex subunit 5)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 126003
Gene name Trafficking protein particle complex subunit 5
Gene symbol TRAPPC5
Synonyms (NCBI Gene)
TRS31
Chromosome 19
Chromosome location 19p13.2
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
19 Show/Hide all (19)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005515 Function Protein binding IPI 25416956, 28514442, 31515488, 32296183, 33961781
GO:0005737 Component Cytoplasm NAS 27066478
GO:0005783 Component Endoplasmic reticulum IEA
GO:0005794 Component Golgi apparatus IEA
GO:0005829 Component Cytosol TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8IUR0
Protein name Trafficking protein particle complex subunit 5
Protein function May play a role in vesicular transport from endoplasmic reticulum to Golgi.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF04051 TRAPP 29 → 175 Transport protein particle (TRAPP) component Family
Sequence 
MEARFTRGKSALLERALARPRTEVSLSAFALLFSELVQHCQSRVFSVAELQSRLAALGRQ
VGARVLDALVAREKGARRETKVLGALLFVKGAVWKALFGKEADKLEQANDDARTFYIIER
EPLINTYISVPKENSTLNCASFTAGIVEAVLTHSGFPAKVTAHWHKGTTLMIKFEEAVIA
RDRALEGR
Sequence length 188
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
Reactome Pathway
COPII-mediated vesicle transport
RAB GEFs exchange GTP for GDP on RABs
Sort by:
TRAPPC6B 2 shared pathwaysRAB GEFs exchange GTP for GDP on RABs, COPII-mediated vesicle transport Related via 2 shared pathways including RAB GEFs exchange GTP for GDP on RABs, COPII-mediated vesicle transport. TRAPPC3 2 shared pathwaysRAB GEFs exchange GTP for GDP on RABs, COPII-mediated vesicle transport Related via 2 shared pathways including RAB GEFs exchange GTP for GDP on RABs, COPII-mediated vesicle transport. TRAPPC4 2 shared pathwaysRAB GEFs exchange GTP for GDP on RABs, COPII-mediated vesicle transport Related via 2 shared pathways including RAB GEFs exchange GTP for GDP on RABs, COPII-mediated vesicle transport. TRAPPC2L 2 shared pathwaysRAB GEFs exchange GTP for GDP on RABs, COPII-mediated vesicle transport Related via 2 shared pathways including RAB GEFs exchange GTP for GDP on RABs, COPII-mediated vesicle transport. TRAPPC1 2 shared pathwaysRAB GEFs exchange GTP for GDP on RABs, COPII-mediated vesicle transport Related via 2 shared pathways including RAB GEFs exchange GTP for GDP on RABs, COPII-mediated vesicle transport.
Neurodevelopmental disorder Linked via 2 of 5 related genesTRAPPC6B, TRAPPC4 neurodevelopmental disorder with microcephaly, epilepsy, and brain atrophy Linked via 1 of 5 related genesTRAPPC6B Bardet-biedl syndrome Linked via 1 of 5 related genesTRAPPC3 Open angle glaucoma Linked via 1 of 5 related genesTRAPPC3 Schizophrenia Linked via 1 of 5 related genesTRAPPC3