TCAIM (T cell activation inhibitor, mitochondrial)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 285343
Gene name T cell activation inhibitor, mitochondrial
Gene symbol TCAIM
Synonyms (NCBI Gene)
C3orf23TOAG-1TOAG1
Chromosome 3
Chromosome location 3p21.31
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
4
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0005739 Component Mitochondrion HTP 34800366
GO:0005739 Component Mitochondrion IBA
GO:0005739 Component Mitochondrion IDA
GO:0005739 Component Mitochondrion IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
620787 25241 ENSG00000179152
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N3R3
Protein name T-cell activation inhibitor, mitochondrial (Tolerance associated gene-1 protein) (TOAG-1)
Protein function May regulate T-cell apoptosis.
PDB 8I0K
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14687 DUF4460 23 → 133 Domain of unknown function (DUF4460) Family
PF14688 DUF4461 188 → 490 Domain of unknown function (DUF4461) Family
Sequence 
MFCHLRPMRRLCLEKIFPHWFPFSRALSGAEAVNALRPFYFAVHPDFFGQHPVEREINEN
SLKRLSVYLENLQKPGFKSLKPTQLTFYVRETDQSSSDGQEPFSTSGFRAVKFTLHTRDL
LSTVLYILNSCSLSVEHIQSLNTNMHTQPLKEAKRMPDRPIKWDKSYYSFTGFKDPDEDL
EQVSRVETTLTSWLDNNGKSAVKKLKNSLPLRKELDRLKDELSHQLQLSDIRWQRSWGIA
HRCSQLHSLSRLAQQNLETLKKAKGCTIIFTDRSGMSAVGHVMLGTMDVHHHWTKLFERL
PSYFDLQRRLMILEDQISYLLGGIQVVYIEELQPVLTLEEYYSLLDVFYNRLLKSRILFH
PRSLRGLQMILNSDRYAPSLHELGHFNIPTLCDPANLQWFILTKAQQARENMKRKEELKV
IENELIQASTKKFSLEKLYKEPSISSIQMVDCCKRLLEQSLPYLHGMHLCISHFYSVMQD
GDLCIPWNWKNGEAIK
Sequence length 496
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
10
Download as csvDownload as pdf
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Show/Hide Unknown Diseases (10)
Phenotype Name Clinical Significance Source Reference Evidence Score
ANOREXIA NERVOSA — GWAS catalog 31835028
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER — GWAS catalog 31835028
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER — GWAS catalog 31835028
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER — GWAS catalog 31835028, 31926635
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER — GWAS catalog 31835028, 31926635
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Carcinoma Renal Cell Renal cell carcinoma Pubtator 35238167 Inhibit
★★★★★
★☆☆☆☆
Found in Text Mining only
Psoriasis Psoriasis BEFREE 19684086
★★★★★
★☆☆☆☆
Found in Text Mining only
Sort by:
C8orf90 3 shared diseasesAnorexia nervosa, Tourette syndrome, Obsessive-compulsive disorder 3 shared evidence sourcesGWAS catalog (Anorexia nervosa), GWAS catalog (Obsessive-compulsive disorder), GWAS catalog (Tourette syndrome) Related via 3 shared diseases including Anorexia nervosa, Tourette syndrome — evidence mostly GWAS catalog. DGKI 3 shared diseasesAnorexia nervosa, Tourette syndrome, Obsessive-compulsive disorder 3 shared evidence sourcesGWAS catalog (Anorexia nervosa), GWAS catalog (Obsessive-compulsive disorder), GWAS catalog (Tourette syndrome) Related via 3 shared diseases including Anorexia nervosa, Tourette syndrome — evidence mostly GWAS catalog. HSPE1-MOB4 3 shared diseasesAnorexia nervosa, Tourette syndrome, Obsessive-compulsive disorder 3 shared evidence sourcesGWAS catalog (Anorexia nervosa), GWAS catalog (Obsessive-compulsive disorder), GWAS catalog (Tourette syndrome) Related via 3 shared diseases including Anorexia nervosa, Tourette syndrome — evidence mostly GWAS catalog. MOB4 3 shared diseasesAnorexia nervosa, Tourette syndrome, Obsessive-compulsive disorder 3 shared evidence sourcesGWAS catalog (Anorexia nervosa), GWAS catalog (Obsessive-compulsive disorder), GWAS catalog (Tourette syndrome) Related via 3 shared diseases including Anorexia nervosa, Tourette syndrome — evidence mostly GWAS catalog. NAA40 3 shared diseasesAnorexia nervosa, Tourette syndrome, Obsessive-compulsive disorder 3 shared evidence sourcesGWAS catalog (Anorexia nervosa), GWAS catalog (Obsessive-compulsive disorder), GWAS catalog (Tourette syndrome) Related via 3 shared diseases including Anorexia nervosa, Tourette syndrome — evidence mostly GWAS catalog.
Insomnia Linked via 3 of 5 related genesDGKI, HSPE1-MOB4, MOB4 Alzheimer disease Linked via 2 of 5 related genesC8orf90, DGKI Obesity Linked via 2 of 5 related genesC8orf90, DGKI Central nervous system cancer Linked via 1 of 5 related genesDGKI Glioblastoma Linked via 1 of 5 related genesDGKI