TAS2R9 (taste 2 receptor member 9)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 50835
Gene name Taste 2 receptor member 9
Gene symbol TAS2R9
Synonyms (NCBI Gene)
T2R9TRB6
Chromosome 12
Chromosome location 12p13.2
Summary This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organiz
miRNA miRNA information provided by mirtarbase database.
4
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT030201 hsa-miR-26b-5p Microarray 19088304
MIRT1411583 hsa-miR-362-5p CLIP-seq
MIRT1411584 hsa-miR-4793-5p CLIP-seq
MIRT1411585 hsa-miR-500b CLIP-seq
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12 Show/Hide all (12)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001580 Process Detection of chemical stimulus involved in sensory perception of bitter taste IBA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
GO:0007165 Process Signal transduction IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604795 14917 ENSG00000121381
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NYW1
Protein name Taste receptor type 2 member 9 (T2R9) (Taste receptor family B member 6) (TRB6)
Protein function Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5 (By similarity).
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05296 TAS2R 1 → 301 Taste receptor protein (TAS2R) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.
Sequence 
MPSAIEAIYIILIAGELTIGIWGNGFIVLVNCIDWLKRRDISLIDIILISLAISRICLLC
VISLDGFFMLLFPGTYGNSVLVSIVNVVWTFANNSSLWFTSCLSIFYLLKIANISHPFFF
WLKLKINKVMLAILLGSFLISLIISVPKNDDMWYHLFKVSHEENITWKFKVSKIPGTFKQ
LTLNLGVMVPFILCLISFFLLLFSLVRHTKQIRLHATGFRDPSTEAHMRAIKAVIIFLLL
LIVYYPVFLVMTSSALIPQGKLVLMIGDIVTVIFPSSHSFILIMGNSKLREAFLKMLRFV
KCFLRRRKPFVP
Sequence length 312
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Taste transduction G alpha (i) signalling events
  Class C/3 (Metabotropic glutamate/pheromone receptors)
Sort by:
TAS2R39 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R40 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R41 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R43 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R31 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events.

No additional diseases found yet through genes similar to TAS2R9.