TAS2R31 (taste 2 receptor member 31)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 259290
Gene name Taste 2 receptor member 31
Gene symbol TAS2R31
Synonyms (NCBI Gene)
T2R31T2R44T2R53TAS2R44
Chromosome 12
Chromosome location 12p13.2
Summary TAS2R44 belongs to the large TAS2R receptor family. TAS2Rs are expressed on the surface of taste receptor cells and mediate the perception of bitterness through a G protein-coupled second messenger pathway (Conte et al., 2002 [PubMed 12584440]). For furth
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001580 Process Detection of chemical stimulus involved in sensory perception of bitter taste IBA
GO:0001580 Process Detection of chemical stimulus involved in sensory perception of bitter taste IDA 20022913
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
612669 19113 ENSG00000256436
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P59538
Protein name Taste receptor type 2 member 31 (T2R31) (Taste receptor type 2 member 44) (T2R44) (Taste receptor type 2 member 53) (T2R53)
Protein function Receptor that may play a role in the perception of bitterness and is gustducin-linked. May play a role in sensing the chemical composition of the gastrointestinal content. The activity of this receptor may stimulate alpha gustducin, mediate PLC-
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05296 TAS2R 1 → 298 Taste receptor protein (TAS2R) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells.
Sequence 
MTTFIPIIFSSVVVVLFVIGNFANGFIALVNSIERVKRQKISFADQILTALAVSRVGLLW
VLLLNWYSTVFNPAFYSVEVRTTAYNVWAVTGHFSNWLATSLSIFYLLKIANFSNLIFLH
LKRRVKSVILVMLLGPLLFLACQLFVINMKEIVRTKEYEGNLTWKIKLRSAVYLSDATVT
TLGNLVPFTLTLLCFLLLICSLCKHLKKMQLHGKGSQDPSTKVHIKALQTVIFFLLLCAV
YFLSIMISVWSFGSLENKPVFMFCKAIRFSYPSIHPFILIWGNKKLKQTFLSVLRQVRYW
VKGEKPSSP
Sequence length 309
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Taste transduction G alpha (i) signalling events
  Class C/3 (Metabotropic glutamate/pheromone receptors)
Sort by:
TAS2R39 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R40 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R41 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R43 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R46 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events.

No additional diseases found yet through genes similar to TAS2R31.