TAS2R40 (taste 2 receptor member 40)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 259286
Gene name Taste 2 receptor member 40
Gene symbol TAS2R40
Synonyms (NCBI Gene)
GPR60T2R40T2R58
Chromosome 7
Chromosome location 7q34
Summary This gene encodes a member of the bitter taste receptor family which belong to the G protein-coupled receptor superfamily and are predominantly expressed in taste receptor cells of the tongue and palate epithelia. This intronless taste receptor gene encod
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001580 Process Detection of chemical stimulus involved in sensory perception of bitter taste IBA
GO:0001580 Process Detection of chemical stimulus involved in sensory perception of bitter taste IDA 20022913
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
613964 18885 ENSG00000221937
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P59535
Protein name Taste receptor type 2 member 40 (T2R40) (G-protein coupled receptor 60) (Taste receptor type 2 member 58) (T2R58)
Protein function Gustducin-coupled receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05296 TAS2R 13 → 314 Taste receptor protein (TAS2R) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in subsets of taste receptor cells of the tongue and exclusively in gustducin-positive cells.
Sequence 
MATVNTDATDKDISKFKVTFTLVVSGIECITGILGSGFITAIYGAEWARGKTLPTGDRIM
LMLSFSRLLLQIWMMLENIFSLLFRIVYNQNSVYILFKVITVFLNHSNLWFAAWLKVFYC
LRIANFNHPLFFLMKRKIIVLMPWLLRLSVLVSLSFSFPLSRDVFNVYVNSSIPIPSSNS
TEKKYFSETNMVNLVFFYNMGIFVPLIMFILAATLLILSLKRHTLHMGSNATGSRDPSMK
AHIGAIKATSYFLILYIFNAIALFLSTSNIFDTYSSWNILCKIIMAAYPAGHSVQLILGN
PGLRRAWKRFQHQVPLYLKGQTL
Sequence length 323
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Taste transduction G alpha (i) signalling events
  Class C/3 (Metabotropic glutamate/pheromone receptors)
Sort by:
TAS2R39 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R41 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R43 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R31 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R46 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events.

No additional diseases found yet through genes similar to TAS2R40.