TAS2R4 (taste 2 receptor member 4)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Related genes Diseases linked via similar genes

Gene

• Entrez ID: 50832
• Gene name: Taste 2 receptor member 4
• Gene symbol: TAS2R4
• Synonyms (NCBI Gene): T2R4
• Chromosome: 7
• Chromosome location: 7q34
• Summary: This gene encodes a member of a family of candidate taste receptors that are members of the G protein-coupled receptor superfamily and that are specifically expressed by taste receptor cells of the tongue and palate epithelia. These apparently intronless

miRNA Show/Hide all (18)

miRTarBase ID	miRNA	Experiments	Reference
MIRT724728	hsa-miR-8084	HITS-CLIP	19536157
MIRT724727	hsa-miR-34b-3p	HITS-CLIP	19536157
MIRT724726	hsa-miR-138-1-3p	HITS-CLIP	19536157
MIRT724725	hsa-miR-3124-3p	HITS-CLIP	19536157
MIRT724724	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT724723	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT724722	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT724721	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT724720	hsa-miR-1238-3p	HITS-CLIP	19536157
MIRT724728	hsa-miR-8084	HITS-CLIP	19536157
MIRT724727	hsa-miR-34b-3p	HITS-CLIP	19536157
MIRT724726	hsa-miR-138-1-3p	HITS-CLIP	19536157
MIRT724725	hsa-miR-3124-3p	HITS-CLIP	19536157
MIRT724724	hsa-miR-7111-3p	HITS-CLIP	19536157
MIRT724723	hsa-miR-6780a-3p	HITS-CLIP	19536157
MIRT724722	hsa-miR-6881-3p	HITS-CLIP	19536157
MIRT724721	hsa-miR-670-3p	HITS-CLIP	19536157
MIRT724720	hsa-miR-1238-3p	HITS-CLIP	19536157

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IBA
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IDA	20022913
GO:0001580	Process	Detection of chemical stimulus involved in sensory perception of bitter taste	IEA
GO:0004930	Function	G protein-coupled receptor activity	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005929	Component	Cilium	IEA
GO:0007165	Process	Signal transduction	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007585	Process	Respiratory gaseous exchange by respiratory system	IEA
GO:0008527	Function	Taste receptor activity	TAS	10761934
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IC	20022913
GO:0016020	Component	Membrane	IEA
GO:0033038	Function	Bitter taste receptor activity	IBA
GO:0033038	Function	Bitter taste receptor activity	IDA	20022913
GO:0033038	Function	Bitter taste receptor activity	IEA
GO:0042995	Component	Cell projection	IEA
GO:0050909	Process	Sensory perception of taste	IEA
GO:0060170	Component	Ciliary membrane	IEA

Other IDs

• MIM: 604869
• HGNC: 14911
• e!Ensembl: ENSG00000127364

Protein

• UniProt ID: Q9NYW5
• Protein name: Taste receptor type 2 member 4 (T2R4)
• Protein function: Gustducin-coupled receptor for denatonium and N(6)-propyl-2-thiouracil implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5. In a
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF05296	TAS2R	1 → 299	Taste receptor protein (TAS2R)	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells. Expressed on airway ciliated epithelium. {ECO:0000269|PubMed:19628819}.
• Sequence:

  MLRLFYFSAIIASVILNFVGIIMNLFITVVNCKTWVKSHRISSSDRILFSLGITRFLMLG
  LFLVNTIYFVSSNTERSVYLSAFFVLCFMFLDSSSVWFVTLLNILYCVKITNFQHSVFLL
  LKRNISPKIPRLLLACVLISAFTTCLYITLSQASPFPELVTTRNNTSFNISEGILSLVVS
  LVLSSSLQFIINVTSASLLIHSLRRHIQKMQKNATGFWNPQTEAHVGAMKLMVYFLILYI
  PYSVATLVQYLPFYAGMDMGTKSICLIFATLYSPGHSVLIIITHPKLKTTAKKILCFKK

• Sequence length: 299

Pathways

KEGG Pathway	Reactome Pathway
Taste transduction	G alpha (i) signalling events
	Class C/3 (Metabotropic glutamate/pheromone receptors)

Related Genes

Sort by: Blended Diseases Pathways Evidence source

TAS2R39 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R40 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R41 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R43 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R31 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
TAS2R39	0	[]	3	["Taste transduction","G alpha (i) signalling events","Class C\/3 (Metabotropic glutamate\/pheromone receptors)"]	0	[]
TAS2R40	0	[]	3	["Taste transduction","G alpha (i) signalling events","Class C\/3 (Metabotropic glutamate\/pheromone receptors)"]	0	[]
TAS2R41	0	[]	3	["Taste transduction","G alpha (i) signalling events","Class C\/3 (Metabotropic glutamate\/pheromone receptors)"]	0	[]
TAS2R43	0	[]	3	["Taste transduction","G alpha (i) signalling events","Class C\/3 (Metabotropic glutamate\/pheromone receptors)"]	0	[]
TAS2R31	0	[]	3	["Taste transduction","G alpha (i) signalling events","Class C\/3 (Metabotropic glutamate\/pheromone receptors)"]	0	[]

Diseases Linked via Similar Genes

No additional diseases found yet through genes similar to TAS2R4.