TAS2R10 (taste 2 receptor member 10)

Download as csv Download as pdf
Log in to save this analysis

Save This Analysis

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 50839
Gene name Taste 2 receptor member 10
Gene symbol TAS2R10
Synonyms (NCBI Gene)
T2R10TRB2
Chromosome 12
Chromosome location 12p13.2
Summary This gene product belongs to the family of candidate taste receptors that are members of the G-protein-coupled receptor superfamily. These proteins are specifically expressed in the taste receptor cells of the tongue and palate epithelia. They are organiz
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT029510 hsa-miR-26b-5p Microarray 19088304
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
14 Show/Hide all (14)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001580 Process Detection of chemical stimulus involved in sensory perception of bitter taste IDA 20022913
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0005515 Function Protein binding IPI 32296183
GO:0005886 Component Plasma membrane IEA
GO:0005886 Component Plasma membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604791 14918 ENSG00000121318
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9NYW0
Protein name Taste receptor type 2 member 10 (T2R10) (Taste receptor family B member 2) (TRB2)
Protein function Gustducin-coupled strychnine receptor implicated in the perception of bitter compounds in the oral cavity and the gastrointestinal tract. Signals through PLCB2 and the calcium-regulated cation channel TRPM5.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF05296 TAS2R 1 → 296 Taste receptor protein (TAS2R) Family
Tissue specificity TISSUE SPECIFICITY: Expressed in subsets of taste receptor cells of the tongue and palate epithelium and exclusively in gustducin-positive cells.
Sequence 
MLRVVEGIFIFVVVSESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWI
IITDGFIQIFSPNIYASGNLIEYISYFWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLW
LKSRTNMVLPFMIVFLLISSLLNFAYIAKILNDYKTKNDTVWDLNMYKSEYFIKQILLNL
GVIFFFTLSLITCIFLIISLWRHNRQMQSNVTGLRDSNTEAHVKAMKVLISFIILFILYF
IGMAIEISCFTVRENKLLLMFGMTTTAIYPWGHSFILILGNSKLKQASLRVLQQLKCCEK
RKNLRVT
Sequence length 307
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Taste transduction G alpha (i) signalling events
  Class C/3 (Metabotropic glutamate/pheromone receptors)
Sort by:
TAS2R39 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R40 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R41 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R43 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events. TAS2R31 3 shared pathwaysTaste transduction, G alpha (i) signalling events, Class C/3 (Metabotropic glutamate/pheromone receptors) Related via 3 shared pathways including Taste transduction, G alpha (i) signalling events.

No additional diseases found yet through genes similar to TAS2R10.