TARBP2 (TARBP2 subunit of RISC loading complex)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 6895
• Gene name: TARBP2 subunit of RISC loading complex
• Gene symbol: TARBP2
• Synonyms (NCBI Gene): LOQS, TRBP, TRBP1, TRBP2
• Chromosome: 12
• Chromosome location: 12q13.13
• Summary: HIV-1, the causative agent of acquired immunodeficiency syndrome (AIDS), contains an RNA genome that produces a chromosomally integrated DNA during the replicative cycle. Activation of HIV-1 gene expression by the transactivator Tat is dependent on an RNA

miRNA Show/Hide all (164)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027513	hsa-miR-98-5p	Microarray	19088304
MIRT029188	hsa-miR-26b-5p	Microarray	19088304
MIRT065734	hsa-miR-6856-3p	PAR-CLIP	20371350
MIRT553757	hsa-miR-4524b-3p	PAR-CLIP	20371350
MIRT065711	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT065715	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT065712	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT065716	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT065719	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT065721	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT065733	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT065723	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT065717	hsa-miR-330-3p	PAR-CLIP	20371350
MIRT065727	hsa-miR-3155a	PAR-CLIP	20371350
MIRT065728	hsa-miR-3155b	PAR-CLIP	20371350
MIRT065720	hsa-miR-484	PAR-CLIP	20371350
MIRT065729	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT065730	hsa-miR-4673	PAR-CLIP	20371350
MIRT553756	hsa-miR-628-3p	PAR-CLIP	20371350
MIRT065718	hsa-miR-325	PAR-CLIP	20371350
MIRT065713	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT065714	hsa-miR-107	PAR-CLIP	20371350
MIRT065724	hsa-miR-1301-5p	PAR-CLIP	20371350
MIRT065731	hsa-miR-6502-5p	PAR-CLIP	20371350
MIRT065732	hsa-miR-6822-3p	PAR-CLIP	20371350
MIRT065723	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT065734	hsa-miR-6856-3p	PAR-CLIP	21572407
MIRT553757	hsa-miR-4524b-3p	PAR-CLIP	21572407
MIRT065711	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT065715	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT065712	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT065716	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT065719	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT065721	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT065733	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT065723	hsa-miR-411-5p	PAR-CLIP	21572407
MIRT065717	hsa-miR-330-3p	PAR-CLIP	21572407
MIRT065727	hsa-miR-3155a	PAR-CLIP	21572407
MIRT065728	hsa-miR-3155b	PAR-CLIP	21572407
MIRT065720	hsa-miR-484	PAR-CLIP	21572407
MIRT065729	hsa-miR-4645-5p	PAR-CLIP	21572407
MIRT065730	hsa-miR-4673	PAR-CLIP	21572407
MIRT553756	hsa-miR-628-3p	PAR-CLIP	21572407
MIRT065718	hsa-miR-325	PAR-CLIP	21572407
MIRT065713	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT065714	hsa-miR-107	PAR-CLIP	21572407
MIRT065724	hsa-miR-1301-5p	PAR-CLIP	21572407
MIRT065731	hsa-miR-6502-5p	PAR-CLIP	21572407
MIRT065732	hsa-miR-6822-3p	PAR-CLIP	21572407
MIRT065723	hsa-miR-411-5p	PAR-CLIP	21572407
MIRT736944	hsa-miR-378g	Western blotting, RNA-seq	32737406
MIRT065734	hsa-miR-6856-3p	PAR-CLIP	20371350
MIRT553757	hsa-miR-4524b-3p	PAR-CLIP	20371350
MIRT065711	hsa-miR-15a-5p	PAR-CLIP	20371350
MIRT065715	hsa-miR-15b-5p	PAR-CLIP	20371350
MIRT065712	hsa-miR-16-5p	PAR-CLIP	20371350
MIRT065716	hsa-miR-195-5p	PAR-CLIP	20371350
MIRT065719	hsa-miR-424-5p	PAR-CLIP	20371350
MIRT065721	hsa-miR-497-5p	PAR-CLIP	20371350
MIRT065733	hsa-miR-6838-5p	PAR-CLIP	20371350
MIRT065723	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT065717	hsa-miR-330-3p	PAR-CLIP	20371350
MIRT065727	hsa-miR-3155a	PAR-CLIP	20371350
MIRT065728	hsa-miR-3155b	PAR-CLIP	20371350
MIRT065720	hsa-miR-484	PAR-CLIP	20371350
MIRT065729	hsa-miR-4645-5p	PAR-CLIP	20371350
MIRT065730	hsa-miR-4673	PAR-CLIP	20371350
MIRT553756	hsa-miR-628-3p	PAR-CLIP	20371350
MIRT065718	hsa-miR-325	PAR-CLIP	20371350
MIRT065713	hsa-miR-103a-3p	PAR-CLIP	20371350
MIRT065714	hsa-miR-107	PAR-CLIP	20371350
MIRT065724	hsa-miR-1301-5p	PAR-CLIP	20371350
MIRT065731	hsa-miR-6502-5p	PAR-CLIP	20371350
MIRT065732	hsa-miR-6822-3p	PAR-CLIP	20371350
MIRT065723	hsa-miR-411-5p	PAR-CLIP	20371350
MIRT065734	hsa-miR-6856-3p	PAR-CLIP	21572407
MIRT553757	hsa-miR-4524b-3p	PAR-CLIP	21572407
MIRT065711	hsa-miR-15a-5p	PAR-CLIP	21572407
MIRT065715	hsa-miR-15b-5p	PAR-CLIP	21572407
MIRT065712	hsa-miR-16-5p	PAR-CLIP	21572407
MIRT065716	hsa-miR-195-5p	PAR-CLIP	21572407
MIRT065719	hsa-miR-424-5p	PAR-CLIP	21572407
MIRT065721	hsa-miR-497-5p	PAR-CLIP	21572407
MIRT065733	hsa-miR-6838-5p	PAR-CLIP	21572407
MIRT065723	hsa-miR-411-5p	PAR-CLIP	21572407
MIRT065717	hsa-miR-330-3p	PAR-CLIP	21572407
MIRT065727	hsa-miR-3155a	PAR-CLIP	21572407
MIRT065728	hsa-miR-3155b	PAR-CLIP	21572407
MIRT065720	hsa-miR-484	PAR-CLIP	21572407
MIRT065729	hsa-miR-4645-5p	PAR-CLIP	21572407
MIRT065730	hsa-miR-4673	PAR-CLIP	21572407
MIRT553756	hsa-miR-628-3p	PAR-CLIP	21572407
MIRT065718	hsa-miR-325	PAR-CLIP	21572407
MIRT065713	hsa-miR-103a-3p	PAR-CLIP	21572407
MIRT065714	hsa-miR-107	PAR-CLIP	21572407
MIRT065724	hsa-miR-1301-5p	PAR-CLIP	21572407
MIRT065731	hsa-miR-6502-5p	PAR-CLIP	21572407
MIRT065732	hsa-miR-6822-3p	PAR-CLIP	21572407
MIRT065723	hsa-miR-411-5p	PAR-CLIP	21572407
MIRT1411380	hsa-let-7a	CLIP-seq
MIRT1411381	hsa-let-7b	CLIP-seq
MIRT1411382	hsa-let-7c	CLIP-seq
MIRT1411383	hsa-let-7d	CLIP-seq
MIRT1411384	hsa-let-7e	CLIP-seq
MIRT1411385	hsa-let-7f	CLIP-seq
MIRT1411386	hsa-let-7g	CLIP-seq
MIRT1411387	hsa-let-7i	CLIP-seq
MIRT1411388	hsa-miR-1273f	CLIP-seq
MIRT1411389	hsa-miR-183	CLIP-seq
MIRT1411390	hsa-miR-2682	CLIP-seq
MIRT1411391	hsa-miR-3714	CLIP-seq
MIRT1411392	hsa-miR-3922-5p	CLIP-seq
MIRT1411393	hsa-miR-3927	CLIP-seq
MIRT1411394	hsa-miR-4257	CLIP-seq
MIRT1411395	hsa-miR-4451	CLIP-seq
MIRT1411396	hsa-miR-4458	CLIP-seq
MIRT1411397	hsa-miR-449c	CLIP-seq
MIRT1411398	hsa-miR-4500	CLIP-seq
MIRT1411399	hsa-miR-4514	CLIP-seq
MIRT1411400	hsa-miR-4692	CLIP-seq
MIRT1411401	hsa-miR-592	CLIP-seq
MIRT1411402	hsa-miR-597	CLIP-seq
MIRT1411403	hsa-miR-622	CLIP-seq
MIRT1411404	hsa-miR-940	CLIP-seq
MIRT1411405	hsa-miR-98	CLIP-seq
MIRT1411380	hsa-let-7a	CLIP-seq
MIRT1411381	hsa-let-7b	CLIP-seq
MIRT1411382	hsa-let-7c	CLIP-seq
MIRT1411383	hsa-let-7d	CLIP-seq
MIRT1411384	hsa-let-7e	CLIP-seq
MIRT1411385	hsa-let-7f	CLIP-seq
MIRT1411386	hsa-let-7g	CLIP-seq
MIRT1411387	hsa-let-7i	CLIP-seq
MIRT2345586	hsa-miR-103a	CLIP-seq
MIRT1411388	hsa-miR-1273f	CLIP-seq
MIRT2345587	hsa-miR-15a	CLIP-seq
MIRT2345588	hsa-miR-15b	CLIP-seq
MIRT2345589	hsa-miR-16	CLIP-seq
MIRT1411389	hsa-miR-183	CLIP-seq
MIRT2345590	hsa-miR-1914	CLIP-seq
MIRT2345591	hsa-miR-195	CLIP-seq
MIRT1411390	hsa-miR-2682	CLIP-seq
MIRT1411391	hsa-miR-3714	CLIP-seq
MIRT1411392	hsa-miR-3922-5p	CLIP-seq
MIRT1411393	hsa-miR-3927	CLIP-seq
MIRT2345592	hsa-miR-424	CLIP-seq
MIRT1411394	hsa-miR-4257	CLIP-seq
MIRT2345593	hsa-miR-4297	CLIP-seq
MIRT1411395	hsa-miR-4451	CLIP-seq
MIRT1411396	hsa-miR-4458	CLIP-seq
MIRT1411397	hsa-miR-449c	CLIP-seq
MIRT1411398	hsa-miR-4500	CLIP-seq
MIRT1411399	hsa-miR-4514	CLIP-seq
MIRT2345594	hsa-miR-4668-3p	CLIP-seq
MIRT1411400	hsa-miR-4692	CLIP-seq
MIRT2345595	hsa-miR-497	CLIP-seq
MIRT2345596	hsa-miR-548c-3p	CLIP-seq
MIRT2345597	hsa-miR-550a	CLIP-seq
MIRT2345598	hsa-miR-558	CLIP-seq
MIRT1411401	hsa-miR-592	CLIP-seq
MIRT1411402	hsa-miR-597	CLIP-seq
MIRT1411403	hsa-miR-622	CLIP-seq
MIRT1411404	hsa-miR-940	CLIP-seq
MIRT1411405	hsa-miR-98	CLIP-seq

Gene ontology (GO) Show/Hide all (67)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002753	Process	Cytoplasmic pattern recognition receptor signaling pathway	IDA	21931555, 23015697, 29441066
GO:0003723	Function	RNA binding	IEA
GO:0003725	Function	Double-stranded RNA binding	IBA
GO:0003725	Function	Double-stranded RNA binding	IDA	23661684, 25608000
GO:0003725	Function	Double-stranded RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	15973356, 16142218, 16424907, 17452327, 17507929, 17531811, 17932509, 18178619, 19668211, 19716330, 19804757, 19820710, 19836333, 21858095, 21900206, 21903422, 23361462, 23622242, 23636329, 23661684, 25416956, 25446899, 25910212, 32296183, 33328224, 33961781, 34578187, 36217029
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	17452327
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006417	Process	Regulation of translation	IEA
GO:0006469	Process	Negative regulation of protein kinase activity	TAS	11641396
GO:0007286	Process	Spermatid development	IEA
GO:0007338	Process	Single fertilization	IEA
GO:0010608	Process	Post-transcriptional regulation of gene expression	IEA
GO:0016442	Component	RISC complex	IBA
GO:0016442	Component	RISC complex	IDA	17531811
GO:0016442	Component	RISC complex	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0019899	Function	Enzyme binding	IPI	25557550
GO:0030422	Process	SiRNA processing	IBA
GO:0030422	Process	SiRNA processing	IDA	15973356, 17452327, 23661684
GO:0030422	Process	SiRNA processing	IEA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0031054	Process	Pre-miRNA processing	IDA	15973356, 16357216, 16424907, 18178619, 23661684
GO:0031054	Process	Pre-miRNA processing	IEA
GO:0035196	Process	MiRNA processing	IDA	15973356, 23661684
GO:0035197	Function	SiRNA binding	IBA
GO:0035197	Function	SiRNA binding	IDA	15973356
GO:0035197	Function	SiRNA binding	IEA
GO:0035198	Function	MiRNA binding	IEA
GO:0035264	Process	Multicellular organism growth	IEA
GO:0036002	Function	Pre-mRNA binding	TAS	19820710
GO:0039532	Process	Negative regulation of cytoplasmic pattern recognition receptor signaling pathway	IDA	30927622
GO:0042802	Function	Identical protein binding	IPI	20211142, 25416956, 32296183
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0042803	Function	Protein homodimerization activity	IPI	17452327
GO:0043403	Process	Skeletal muscle tissue regeneration	IEA
GO:0045070	Process	Positive regulation of viral genome replication	IDA	11641396
GO:0045727	Process	Positive regulation of translation	IEA
GO:0046782	Process	Regulation of viral transcription	IDA	11641396
GO:0046782	Process	Regulation of viral transcription	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050689	Process	Negative regulation of defense response to virus by host	IDA	11641396
GO:0051149	Process	Positive regulation of muscle cell differentiation	IEA
GO:0051246	Process	Regulation of protein metabolic process	IEA
GO:0061351	Process	Neural precursor cell proliferation	IEA
GO:0070534	Process	Protein K63-linked ubiquitination	IDA	23015697
GO:0070578	Component	RISC-loading complex	IBA
GO:0070578	Component	RISC-loading complex	IDA	15973356, 16357216, 17531811, 18178619, 19820710, 23661684
GO:0070578	Component	RISC-loading complex	IEA
GO:0070578	Component	RISC-loading complex	IPI	23661684
GO:0070883	Function	Pre-miRNA binding	IDA	18178619
GO:0070883	Function	Pre-miRNA binding	IDA	23435228, 23661684
GO:0070883	Function	Pre-miRNA binding	IEA
GO:0070920	Process	Regulation of regulatory ncRNA processing	IBA
GO:0070921	Process	Regulation of siRNA processing	IEA
GO:0070922	Process	RISC complex assembly	IDA	15973356, 18178619, 23661684
GO:0070922	Process	RISC complex assembly	IEA
GO:0098795	Process	Global gene silencing by mRNA cleavage	IEA
GO:0098795	Process	Global gene silencing by mRNA cleavage	IMP	15973356
GO:0140311	Function	Protein sequestering activity	IDA	30927622
GO:1903798	Process	Regulation of miRNA processing	IEA
GO:1903798	Process	Regulation of miRNA processing	IEA

Other IDs

• MIM: 605053
• HGNC: 11569
• e!Ensembl: ENSG00000139546

Protein

• UniProt ID: Q15633
• Protein name: RISC-loading complex subunit TARBP2 (TAR RNA-binding protein 2) (Trans-activation-responsive RNA-binding protein)
• Protein function: Required for formation of the RNA induced silencing complex (RISC). Component of the RISC loading complex (RLC), also known as the micro-RNA (miRNA) loading complex (miRLC), which is composed of DICER1, AGO2 and TARBP2. Within the RLC/miRLC, DIC
• PDB: 2CPN , 3ADL , 3LLH , 4WYQ , 5N8L , 5N8M , 5ZAK , 5ZAL , 5ZAM , 6ZBK
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00035	dsrm	160 → 225	Double-stranded RNA binding motif	Domain
  PF00035	dsrm	31 → 95	Double-stranded RNA binding motif	Domain

• Sequence:

  MSEEEQGSGTTTGCGLPSIEQMLAANPGKTPISLLQEYGTRIGKTPVYDLLKAEGQAHQP
  NFTFRVTVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDSSLPE
  DIPVFTAAAAATPVPSVVLTRSPPMELQPPVSPQQSECNPVGALQELVVQKGWRLPEYTV
  TQESGPAHRKEFTMTCRVERFIEIGSGTSKKLAKRNAAAKMLLRVHTVPLDARDGNEVEP
  DDDHFSIGVGSRLDGLRNRGPGCTWDSLRNSVGEKILSLRSCSLGSLGALGPACCRVLSE
  LSEEQAFHVSYLDIEELSLSGLCQCLVELSTQPATVCHGSATTREAARGEAARRALQYLK
  IMAGSK

• Sequence length: 366

Pathways

Reactome Pathway

MicroRNA (miRNA) biogenesis

Small interfering RNA (siRNA) biogenesis

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (13)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (37)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenoma	Adenoma	BEFREE	26087193		★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	23671264		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	23671264	Associate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	16343534		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24563327, 25043050, 30759864		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	21346411, 25043050, 35008634	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	33484209	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	21346411, 23671264, 26087193		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	26688807		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	31300274		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	25793711		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	31510013	Associate	★☆☆☆☆ Found in Text Mining only
Ectodermal Dysplasia	Ectodermal dysplasia	Pubtator	23671264	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	22698405		★☆☆☆☆ Found in Text Mining only
Hidradenitis Suppurativa	Hidradenitis suppurativa	BEFREE	28634830		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	25043050		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	25043050	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35008634	Associate	★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	27599909		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	26688807	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33484209	Stimulate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24563327, 30759864		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	26688807		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31300274		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20957285		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	22025453		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19219043, 22698405, 24563327		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	25043050		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	26660531	Stimulate	★☆☆☆☆ Found in Text Mining only
Migraine with Aura	Migraine	Pubtator	26660531	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19219043, 21368194, 22698405, 23671264, 24563327, 26087193, 31300274		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27599909		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	30759864		★☆☆☆☆ Found in Text Mining only
Pleuropulmonary blastoma	Pleuropulmonary blastoma	BEFREE	21346411		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23644875	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24563327		★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	23690119		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

DICER1 2 shared pathwaysMicroRNA (miRNA) biogenesis, Small interfering RNA (siRNA) biogenesis Related via 2 shared pathways including MicroRNA (miRNA) biogenesis, Small interfering RNA (siRNA) biogenesis. PRKRA 2 shared pathwaysMicroRNA (miRNA) biogenesis, Small interfering RNA (siRNA) biogenesis Related via 2 shared pathways including MicroRNA (miRNA) biogenesis, Small interfering RNA (siRNA) biogenesis. AGO2 2 shared pathwaysMicroRNA (miRNA) biogenesis, Small interfering RNA (siRNA) biogenesis Related via 2 shared pathways including MicroRNA (miRNA) biogenesis, Small interfering RNA (siRNA) biogenesis. AGO3 2 shared pathwaysMicroRNA (miRNA) biogenesis, Small interfering RNA (siRNA) biogenesis Related via 2 shared pathways including MicroRNA (miRNA) biogenesis, Small interfering RNA (siRNA) biogenesis. AGO4 2 shared pathwaysMicroRNA (miRNA) biogenesis, Small interfering RNA (siRNA) biogenesis Related via 2 shared pathways including MicroRNA (miRNA) biogenesis, Small interfering RNA (siRNA) biogenesis.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
DICER1	0	[]	2	["MicroRNA (miRNA) biogenesis","Small interfering RNA (siRNA) biogenesis"]	0	[]
PRKRA	0	[]	2	["MicroRNA (miRNA) biogenesis","Small interfering RNA (siRNA) biogenesis"]	0	[]
AGO2	0	[]	2	["MicroRNA (miRNA) biogenesis","Small interfering RNA (siRNA) biogenesis"]	0	[]
AGO3	0	[]	2	["MicroRNA (miRNA) biogenesis","Small interfering RNA (siRNA) biogenesis"]	0	[]
AGO4	0	[]	2	["MicroRNA (miRNA) biogenesis","Small interfering RNA (siRNA) biogenesis"]	0	[]

Diseases Linked via Similar Genes

Neurodevelopmental disorder Linked via 2 of 5 related genesDICER1, AGO2 Schizophrenia Linked via 2 of 5 related genesDICER1, AGO4 Eczema Linked via 2 of 5 related genesPRKRA, AGO2 Dicer1 syndrome Linked via 1 of 5 related genesDICER1 Dicer1 tumor-predisposition syndrome Linked via 1 of 5 related genesDICER1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Neurodevelopmental disorder	2	["DICER1","AGO2"]
Schizophrenia	2	["DICER1","AGO4"]
Eczema	2	["PRKRA","AGO2"]
Dicer1 syndrome	1	["DICER1"]
Dicer1 tumor-predisposition syndrome	1	["DICER1"]