Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	83860
Gene name	TATA-box binding protein associated factor 3
Gene symbol	TAF3
Synonyms (NCBI Gene)	TAF140TAFII-140TAFII140
Chromosome	10
Chromosome location	10p14
Summary	The highly conserved RNA polymerase II transcription factor TFIID (see TAF1; MIM 313650) comprises the TATA box-binding protein (TBP; MIM 600075) and a set of TBP-associated factors (TAFs), including TAF3. TAFs contribute to promoter recognition and selec

miRTarBase ID	miRNA	Experiments	Reference
MIRT019668	hsa-miR-375	Microarray	20215506
MIRT035927	hsa-miR-1180-3p	CLASH	23622248

34 Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	18549481
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0002039	Function	P53 binding	IBA
GO:0002039	Function	P53 binding	IEA
GO:0005515	Function	Protein binding	IPI	11438666, 15870280, 20953165, 33961781
GO:0005634	Component	Nucleus	EXP	23332750
GO:0005634	Component	Nucleus	IDA	15870280
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005669	Component	Transcription factor TFIID complex	IBA
GO:0005669	Component	Transcription factor TFIID complex	IDA	11438666, 29111974
GO:0005669	Component	Transcription factor TFIID complex	IPI	23332750
GO:0005669	Component	Transcription factor TFIID complex	ISS
GO:0006325	Process	Chromatin organization	IEA
GO:0006366	Process	Transcription by RNA polymerase II	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IC	29111974
GO:0031965	Component	Nuclear membrane	IDA
GO:0042789	Process	MRNA transcription by RNA polymerase II	IDA	17884155
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IPI	27007846
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	ISS
GO:0051457	Process	Maintenance of protein location in nucleus	IDA	15870280
GO:0060261	Process	Positive regulation of transcription initiation by RNA polymerase II	IDA	17884155
GO:0140002	Function	Histone H3K4me3 reader activity	IDA	17884155
GO:0140416	Function	Transcription regulator inhibitor activity	IDA	18549481
GO:0140416	Function	Transcription regulator inhibitor activity	IEA
GO:1901797	Process	Negative regulation of signal transduction by p53 class mediator	IDA	18549481
GO:1901797	Process	Negative regulation of signal transduction by p53 class mediator	IEA

MIM	HGNC	e!Ensembl
606576	17303	ENSG00000165632

Q5VWG9

Protein name

Transcription initiation factor TFIID subunit 3 (140 kDa TATA box-binding protein-associated factor) (TBP-associated factor 3) (Transcription initiation factor TFIID 140 kDa subunit) (TAF(II)140) (TAF140) (TAFII-140) (TAFII140)

Protein function

The TFIID basal transcription factor complex plays a major role in the initiation of RNA polymerase II (Pol II)-dependent transcription (PubMed:33795473). TFIID recognizes and binds promoters with or without a TATA box via its subunit TBP, a TAT

PDB

5C13 , 5WXG , 5WXH , 5XMY , 6MZD , 6MZL , 7EDX , 7EG7 , 7EG8 , 7EG9 , 7EGA , 7EGB , 7EGC , 7EGD , 7EGE , 7EGF , 7EGI , 7EGJ , 7ENA , 7ENC , 8GXQ , 8GXS , 8WAK , 8WAL , 8WAN , 8WAO , 8WAP , 8WAQ , 8WAR , 8WAS

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00628	PHD	867 → 915	PHD-finger	Domain
PF07524	Bromo_TP	3 → 79	Bromodomain associated	Domain

Sequence

MCESYSRSLLRVSVAQICQALGWDSVQLSACHLLTDVLQRYLQQLGRGCHRYSELYGRTD
PILDDVGEAFQLMGVSLHELEDYIHNIEPVTFPHQIPSFPVSKNNVLQFPQPGSKDAEER
KEYIPDYLPPIVSSQEEEEEEQVPTDGGTSAEAMQVPLEEDDELEEEEIINDENFLGKRP
LDSPEAEELPAMKRPRLLSTKGDTLDVVLLEAREPLSSINTQKIPPMLSPVHVQDSTDLA
PPSPEPPMLAPVAKSQMPTAKPLETKSFTPKTKTKTSSPGQKTKSPKTAQSPAMVGSPIR
SPKTVSKEKKSPGRSKSPKSPKSPKVTTHIPQTPVRPETPNRTPSATLSEKISKETIQVK
QIQTPPDAGKLNSENQPKKAVVADKTIEASIDAVIARACAEREPDPFEFSSGSESEGDIF
TSPKRISGPECTTPKASTSANNFTKSGSTPLPLSGGTSSSDNSWTMDASIDEVVRKAKLG
TPSNMPPNFPYISSPSVSPPTPEPLHKVYEEKTKLPSSVEVKKKLKKELKTKMKKKEKQR
DREREKDKNKDKSKEKDKVKEKEKDKETGRETKYPWKEFLKEEEADPYKFKIKEFEDVDP
KVKLKDGLVRKEKEKHKDKKKDREKGKKDKDKREKEKVKDKGREDKMKAPAPPLVLPPKE
LALPLFSPATASRVPAMLPSLLPVLPEKLFEEKEKVKEKEKKKDKKEKKKKKEKEKEKKE
KEREKEKREREKREKEKEKHKHEKIKVEPVALAPSPVIPRLTLRVGAGQDKIVISKVVPA
PEAKPAPSQNRPKTPPPAPAPAPGPMLVSPAPVPLPLLAQAAAGPALLPSPGPAASGASA
KAPVRSVVTETVSTYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTA
PPEEMQWFCPKCANKKKDKKHKKRKHRAH

Sequence length

929

Interactions

View interactions

KEGG Pathway	Reactome Pathway
Basal transcription factors	RNA Polymerase II Pre-transcription Events
	Regulation of TP53 Activity through Phosphorylation
	RNA Polymerase II Promoter Escape
	RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
	RNA Polymerase II Transcription Initiation
	RNA Polymerase II Transcription Initiation And Promoter Clearance

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	27082954	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	27835742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	27835742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	31776129	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

Related Gene	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Names
TAF1L	[]	7	["Basal transcription factors","RNA Polymerase II Pre-transcription Events","Regulation of TP53 Activity through Phosphorylation","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	[]
TAF7L	[]	7	["Basal transcription factors","RNA Polymerase II Pre-transcription Events","Regulation of TP53 Activity through Phosphorylation","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	[]
TAF1	[]	7	["Basal transcription factors","RNA Polymerase II Pre-transcription Events","Regulation of TP53 Activity through Phosphorylation","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	[]
TAF2	[]	7	["Basal transcription factors","RNA Polymerase II Pre-transcription Events","Regulation of TP53 Activity through Phosphorylation","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	[]
TAF4	[]	7	["Basal transcription factors","RNA Polymerase II Pre-transcription Events","Regulation of TP53 Activity through Phosphorylation","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	[]

TAF3 (TATA-box binding protein associated factor 3)

Save This Analysis