TAF7L (TATA-box binding protein associated factor 7 like)

Download as csv Download as pdf

Log in to save this analysis

Save This Analysis

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 54457
• Gene name: TATA-box binding protein associated factor 7 like
• Gene symbol: TAF7L
• Synonyms (NCBI Gene): CT40, TAF2Q
• Chromosome: X
• Chromosome location: Xq22.1
• Summary: This gene is similar to a mouse gene that encodes a TATA box binding protein-associated factor, and shows testis-specific expression. The encoded protein could be a spermatogenesis-specific component of the DNA-binding general transcription factor complex

miRNA Show/Hide all (63)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1409775	hsa-miR-1258	CLIP-seq
MIRT1409776	hsa-miR-188-5p	CLIP-seq
MIRT1409777	hsa-miR-3150b-3p	CLIP-seq
MIRT1409778	hsa-miR-3197	CLIP-seq
MIRT1409779	hsa-miR-323-5p	CLIP-seq
MIRT1409780	hsa-miR-3650	CLIP-seq
MIRT1409781	hsa-miR-3664-3p	CLIP-seq
MIRT1409782	hsa-miR-3929	CLIP-seq
MIRT1409783	hsa-miR-4266	CLIP-seq
MIRT1409784	hsa-miR-4267	CLIP-seq
MIRT1409785	hsa-miR-4419b	CLIP-seq
MIRT1409786	hsa-miR-4433	CLIP-seq
MIRT1409787	hsa-miR-4459	CLIP-seq
MIRT1409788	hsa-miR-4478	CLIP-seq
MIRT1409789	hsa-miR-4502	CLIP-seq
MIRT1409790	hsa-miR-4533	CLIP-seq
MIRT1409791	hsa-miR-4649-3p	CLIP-seq
MIRT1409792	hsa-miR-4661-3p	CLIP-seq
MIRT1409793	hsa-miR-4695-5p	CLIP-seq
MIRT1409794	hsa-miR-4768-3p	CLIP-seq
MIRT1409795	hsa-miR-4779	CLIP-seq
MIRT1409796	hsa-miR-4784	CLIP-seq
MIRT1409797	hsa-miR-485-5p	CLIP-seq
MIRT1409798	hsa-miR-510	CLIP-seq
MIRT1409799	hsa-miR-512-5p	CLIP-seq
MIRT1409800	hsa-miR-548ac	CLIP-seq
MIRT1409801	hsa-miR-548ae	CLIP-seq
MIRT1409802	hsa-miR-548aj	CLIP-seq
MIRT1409803	hsa-miR-548am	CLIP-seq
MIRT1409804	hsa-miR-548d-3p	CLIP-seq
MIRT1409805	hsa-miR-548x	CLIP-seq
MIRT1409806	hsa-miR-548z	CLIP-seq
MIRT1409807	hsa-miR-578	CLIP-seq
MIRT1409808	hsa-miR-765	CLIP-seq
MIRT1409809	hsa-miR-876-3p	CLIP-seq
MIRT1409775	hsa-miR-1258	CLIP-seq
MIRT1409777	hsa-miR-3150b-3p	CLIP-seq
MIRT1409783	hsa-miR-4266	CLIP-seq
MIRT1409810	hsa-miR-4434	CLIP-seq
MIRT1409789	hsa-miR-4502	CLIP-seq
MIRT1409811	hsa-miR-4516	CLIP-seq
MIRT1409793	hsa-miR-4695-5p	CLIP-seq
MIRT1409795	hsa-miR-4779	CLIP-seq
MIRT1409796	hsa-miR-4784	CLIP-seq
MIRT1409808	hsa-miR-765	CLIP-seq
MIRT2122801	hsa-miR-1183	CLIP-seq
MIRT2122802	hsa-miR-2114	CLIP-seq
MIRT1409781	hsa-miR-3664-3p	CLIP-seq
MIRT1409786	hsa-miR-4433	CLIP-seq
MIRT1409787	hsa-miR-4459	CLIP-seq
MIRT1409793	hsa-miR-4695-5p	CLIP-seq
MIRT1409794	hsa-miR-4768-3p	CLIP-seq
MIRT1409798	hsa-miR-510	CLIP-seq
MIRT1409799	hsa-miR-512-5p	CLIP-seq
MIRT2395505	hsa-miR-767-3p	CLIP-seq
MIRT2461102	hsa-miR-1285	CLIP-seq
MIRT2461103	hsa-miR-3157-5p	CLIP-seq
MIRT2461104	hsa-miR-3187-5p	CLIP-seq
MIRT2461105	hsa-miR-3667-5p	CLIP-seq
MIRT2461106	hsa-miR-4452	CLIP-seq
MIRT2461107	hsa-miR-4803	CLIP-seq
MIRT2461108	hsa-miR-612	CLIP-seq
MIRT2461109	hsa-miR-661	CLIP-seq

Gene ontology (GO) Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IEA
GO:0005669	Component	Transcription factor TFIID complex	IBA
GO:0005669	Component	Transcription factor TFIID complex	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0006367	Process	Transcription initiation at RNA polymerase II promoter	IEA
GO:0007283	Process	Spermatogenesis	IEA
GO:0016251	Function	RNA polymerase II general transcription initiation factor activity	IBA
GO:0030154	Process	Cell differentiation	IEA
GO:0051123	Process	RNA polymerase II preinitiation complex assembly	IBA

Other IDs

• MIM: 300314
• HGNC: 11548
• e!Ensembl: ENSG00000102387

Protein

• UniProt ID: Q5H9L4
• Protein name: Transcription initiation factor TFIID subunit 7-like (Cancer/testis antigen 40) (CT40) (RNA polymerase II TBP-associated factor subunit Q) (TATA box-binding protein-associated factor 50 kDa) (Transcription initiation factor TFIID 50 kDa subunit)
• Protein function: Probably functions as a spermatogenesis-specific component of the DNA-binding general transcription factor complex TFIID, a multimeric protein complex that plays a central role in mediating promoter responses to various activators and repressors
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04658	TAFII55_N	98 → 276	TAFII55 protein conserved region	Family

• Tissue specificity: TISSUE SPECIFICITY: Testis-specific. {ECO:0000269|PubMed:11279525}.
• Sequence:

  MECPEGQLPISSENDSTPTVSTSEVTSQQEPQILVDRGSETTYESSADIAGDEGTQIPAD
  EDTQTDADSSAQAAAQAPENFQEGKDMSESQDEVPDEVENQFILRLPLEHACTVRNLARS
  QSVKMKDKLKIDLLPDGRHAVVEVEDVPLAAKLVDLPCVIESLRTLDKKTFYKTADISQM
  LVCTADGDIHLSPEEPAASTDPNIVRKKERGREEKCVWKHGITPPLKNVRKKRFRKTQKK
  VPDVKEMEKSSFTEYIESPDVENEVKRLLRSDAEAVSTRWEVIAEDGTKEIESQGSIPGF
  LISSGMSSHKQGHTSSEYDMLREMFSDSRSNNDDDEDEDDEDEDEDEDEDEDEDKEEEEE
  DCSEEYLERQLQAEFIESGQYRANEGTSSIVMEIQKQIEKKEKKLHKIQNKAQRQKDLIM
  KVENLTLKNHFQSVLEQLELQEKQKNEKLISLQEQLQRFLKK

• Sequence length: 462

Pathways

KEGG Pathway	Reactome Pathway
Basal transcription factors	RNA Polymerase II Pre-transcription Events
	Regulation of TP53 Activity through Phosphorylation
	RNA Polymerase II Promoter Escape
	RNA Polymerase II Transcription Pre-Initiation And Promoter Opening
	RNA Polymerase II Transcription Initiation
	RNA Polymerase II Transcription Initiation And Promoter Clearance

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Nonpapillary renal cell carcinoma	Uncertain significance	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (6)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	26107214		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26107214	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	28763332		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	23292864		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	26107214		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	26107214		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

TAF1L 7 shared pathwaysBasal transcription factors, RNA Polymerase II Pre-transcription Events, Regulation of TP53 Activity through Phosphorylation, RNA Polymerase II Promoter Escape, RNA Polymerase II Transcription Pre-Initiation And Promoter Opening, RNA Polymerase II Transcription Initiation, RNA Polymerase II Transcription Initiation And Promoter Clearance Related via 7 shared pathways including Basal transcription factors, RNA Polymerase II Pre-transcription Events. TAF1 7 shared pathwaysBasal transcription factors, RNA Polymerase II Pre-transcription Events, Regulation of TP53 Activity through Phosphorylation, RNA Polymerase II Promoter Escape, RNA Polymerase II Transcription Pre-Initiation And Promoter Opening, RNA Polymerase II Transcription Initiation, RNA Polymerase II Transcription Initiation And Promoter Clearance Related via 7 shared pathways including Basal transcription factors, RNA Polymerase II Pre-transcription Events. TAF2 7 shared pathwaysBasal transcription factors, RNA Polymerase II Pre-transcription Events, Regulation of TP53 Activity through Phosphorylation, RNA Polymerase II Promoter Escape, RNA Polymerase II Transcription Pre-Initiation And Promoter Opening, RNA Polymerase II Transcription Initiation, RNA Polymerase II Transcription Initiation And Promoter Clearance Related via 7 shared pathways including Basal transcription factors, RNA Polymerase II Pre-transcription Events. TAF4 7 shared pathwaysBasal transcription factors, RNA Polymerase II Pre-transcription Events, Regulation of TP53 Activity through Phosphorylation, RNA Polymerase II Promoter Escape, RNA Polymerase II Transcription Pre-Initiation And Promoter Opening, RNA Polymerase II Transcription Initiation, RNA Polymerase II Transcription Initiation And Promoter Clearance Related via 7 shared pathways including Basal transcription factors, RNA Polymerase II Pre-transcription Events. TAF4B 7 shared pathwaysBasal transcription factors, RNA Polymerase II Pre-transcription Events, Regulation of TP53 Activity through Phosphorylation, RNA Polymerase II Promoter Escape, RNA Polymerase II Transcription Pre-Initiation And Promoter Opening, RNA Polymerase II Transcription Initiation, RNA Polymerase II Transcription Initiation And Promoter Clearance Related via 7 shared pathways including Basal transcription factors, RNA Polymerase II Pre-transcription Events.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
TAF1L	0	[]	7	["Basal transcription factors","RNA Polymerase II Pre-transcription Events","Regulation of TP53 Activity through Phosphorylation","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	0	[]
TAF1	0	[]	7	["Basal transcription factors","RNA Polymerase II Pre-transcription Events","Regulation of TP53 Activity through Phosphorylation","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	0	[]
TAF2	0	[]	7	["Basal transcription factors","RNA Polymerase II Pre-transcription Events","Regulation of TP53 Activity through Phosphorylation","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	0	[]
TAF4	0	[]	7	["Basal transcription factors","RNA Polymerase II Pre-transcription Events","Regulation of TP53 Activity through Phosphorylation","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	0	[]
TAF4B	0	[]	7	["Basal transcription factors","RNA Polymerase II Pre-transcription Events","Regulation of TP53 Activity through Phosphorylation","RNA Polymerase II Promoter Escape","RNA Polymerase II Transcription Pre-Initiation And Promoter Opening","RNA Polymerase II Transcription Initiation","RNA Polymerase II Transcription Initiation And Promoter Clearance"]	0	[]

Diseases Linked via Similar Genes

Intellectual developmental disorder Linked via 3 of 5 related genesTAF1, TAF2, TAF4 Neurodevelopmental disorder Linked via 2 of 5 related genesTAF2, TAF4 Gastrointestinal disease Linked via 1 of 5 related genesTAF1L Prostatic neoplasms Linked via 1 of 5 related genesTAF1L Autism Linked via 1 of 5 related genesTAF1

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Intellectual developmental disorder	3	["TAF1","TAF2","TAF4"]
Neurodevelopmental disorder	2	["TAF2","TAF4"]
Gastrointestinal disease	1	["TAF1L"]
Prostatic neoplasms	1	["TAF1L"]
Autism	1	["TAF1"]