TAAR2 (trace amine associated receptor 2)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 9287
Gene name Trace amine associated receptor 2
Gene symbol TAAR2
Synonyms (NCBI Gene)
GPR58taR-2
Chromosome 6
Chromosome location 6q23.2
miRNA miRNA information provided by mirtarbase database.
1
Download as csvDownload as pdf
miRTarBase ID miRNA Experiments Reference
MIRT019016 hsa-miR-335-5p Microarray 18185580
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
11 Show/Hide all (11)
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0001594 Function Trace-amine receptor activity IBA
GO:0001594 Function Trace-amine receptor activity IEA
GO:0004930 Function G protein-coupled receptor activity IEA
GO:0004930 Function G protein-coupled receptor activity TAS 10684976, 15718104
GO:0005886 Component Plasma membrane IBA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
604849 4514 ENSG00000146378
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9P1P5
Protein name Trace amine-associated receptor 2 (TaR-2) (Trace amine receptor 2) (G-protein coupled receptor 58)
Protein function Orphan olfactory receptor specific for trace amines. Trace amine compounds are enriched in animal body fluids and act on trace amine-associated receptors (TAARs) to elicit both intraspecific and interspecific innate behaviors. Ligand-binding cau
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00001 7tm_1 60 → 315 7 transmembrane receptor (rhodopsin family) Family
Tissue specificity TISSUE SPECIFICITY: Not expressed in the pons, thalamus, hypothalamus, hippocampus, caudate, putamen, frontal cortex, basal forebrain, midbrain or liver. {ECO:0000269|PubMed:10684976}.
Sequence 
MAVSSEQHELSHFKRTQTKKEKFNCSEYGNRSCPENERSLGVRVAMYSFMAGSIFITIFG
NLAMIISISYFKQLHTPTNFLILSMAITDFLLGFTIMPYSMIRSVENCWYFGLTFCKIYY
SFDLMLSITSIFHLCSVAIDRFYAICYPLLYSTKITIPVIKRLLLLCWSVPGAFAFGVVF
SEAYADGIEGYDILVACSSSCPVMFNKLWGTTLFMAGFFTPGSMMVGIYGKIFAVSRKHA
HAINNLRENQNNQVKKDKKAAKTLGIVIGVFLLCWFPCFFTILLDPFLNFSTPVVLFDAL
TWFGYFNSTCNPLIYGFFYPWFRRALKYILLGKIFSSCFHNTILCMQKESE
Sequence length 351
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway Reactome Pathway
Neuroactive ligand-receptor interaction Amine ligand-binding receptors
  G alpha (s) signalling events
  ADORA2B mediated anti-inflammatory cytokines production
Sort by:
TAAR9 3 shared pathwaysG alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production, Amine ligand-binding receptors Related via 3 shared pathways including G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production. TAAR1 3 shared pathwaysG alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production, Amine ligand-binding receptors Related via 3 shared pathways including G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production. TAAR6 3 shared pathwaysG alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production, Amine ligand-binding receptors Related via 3 shared pathways including G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production. TAAR8 3 shared pathwaysG alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production, Amine ligand-binding receptors Related via 3 shared pathways including G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production. TAAR5 3 shared pathwaysG alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production, Amine ligand-binding receptors Related via 3 shared pathways including G alpha (s) signalling events, ADORA2B mediated anti-inflammatory cytokines production.
Dementia Linked via 2 of 5 related genesTAAR9, TAAR8 Prostate cancer Linked via 2 of 5 related genesTAAR6, TAAR5 Schizophrenia Linked via 1 of 5 related genesTAAR1 Bipolar disorder Linked via 1 of 5 related genesTAAR6 Major depressive disorder Linked via 1 of 5 related genesTAAR6