Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	341359
Gene name	Synaptotagmin 10
Gene symbol	SYT10
Synonyms (NCBI Gene)	-
Chromosome	12
Chromosome location	12p11.1

32 Show/Hide all (32)

miRTarBase ID	miRNA	Experiments
MIRT1407129	hsa-miR-1273d	CLIP-seq
MIRT1407130	hsa-miR-155	CLIP-seq
MIRT1407131	hsa-miR-24	CLIP-seq
MIRT1407132	hsa-miR-2681	CLIP-seq
MIRT1407133	hsa-miR-4284	CLIP-seq
MIRT1407134	hsa-miR-4720-3p	CLIP-seq
MIRT1407135	hsa-miR-4804-3p	CLIP-seq
MIRT1407136	hsa-miR-889	CLIP-seq
MIRT2121989	hsa-miR-101	CLIP-seq
MIRT2121990	hsa-miR-144	CLIP-seq
MIRT2121991	hsa-miR-146a	CLIP-seq
MIRT2121992	hsa-miR-146b-5p	CLIP-seq
MIRT1407131	hsa-miR-24	CLIP-seq
MIRT2121993	hsa-miR-3663-3p	CLIP-seq
MIRT2121994	hsa-miR-3920	CLIP-seq
MIRT2121995	hsa-miR-409-3p	CLIP-seq
MIRT1407133	hsa-miR-4284	CLIP-seq
MIRT2121996	hsa-miR-4698	CLIP-seq
MIRT2121997	hsa-miR-4762-3p	CLIP-seq
MIRT2121998	hsa-miR-520d-5p	CLIP-seq
MIRT2121999	hsa-miR-524-5p	CLIP-seq
MIRT2122000	hsa-miR-548c-3p	CLIP-seq
MIRT2122001	hsa-miR-582-5p	CLIP-seq
MIRT2122002	hsa-miR-589	CLIP-seq
MIRT2121990	hsa-miR-144	CLIP-seq
MIRT2344311	hsa-miR-3545-3p	CLIP-seq
MIRT2344312	hsa-miR-3658	CLIP-seq
MIRT2344313	hsa-miR-452	CLIP-seq
MIRT2344314	hsa-miR-4676-3p	CLIP-seq
MIRT2344315	hsa-miR-885-5p	CLIP-seq
MIRT2395469	hsa-miR-532-5p	CLIP-seq
MIRT2121996	hsa-miR-4698	CLIP-seq

33 Show/Hide all (33)

GO ID	Ontology	Definition	Evidence
GO:0000149	Function	SNARE binding	IBA
GO:0000149	Function	SNARE binding	IEA
GO:0001786	Function	Phosphatidylserine binding	IEA
GO:0005509	Function	Calcium ion binding	IEA
GO:0005509	Function	Calcium ion binding	ISS
GO:0005544	Function	Calcium-dependent phospholipid binding	IBA
GO:0005546	Function	Phosphatidylinositol-4,5-bisphosphate binding	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0006887	Process	Exocytosis	IEA
GO:0007268	Process	Chemical synaptic transmission	IBA
GO:0007268	Process	Chemical synaptic transmission	IEA
GO:0007268	Process	Chemical synaptic transmission	ISS
GO:0007608	Process	Sensory perception of smell	IEA
GO:0007608	Process	Sensory perception of smell	ISS
GO:0016020	Component	Membrane	IEA
GO:0016079	Process	Synaptic vesicle exocytosis	ISS
GO:0016192	Process	Vesicle-mediated transport	IBA
GO:0017158	Process	Regulation of calcium ion-dependent exocytosis	IBA
GO:0017158	Process	Regulation of calcium ion-dependent exocytosis	IEA
GO:0030658	Component	Transport vesicle membrane	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042803	Function	Protein homodimerization activity	IEA
GO:0045956	Process	Positive regulation of calcium ion-dependent exocytosis	IEA
GO:0045956	Process	Positive regulation of calcium ion-dependent exocytosis	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0046982	Function	Protein heterodimerization activity	IEA
GO:0061891	Function	Calcium ion sensor activity	IBA
GO:0070382	Component	Exocytic vesicle	IBA
GO:0070382	Component	Exocytic vesicle	IEA
GO:0070382	Component	Exocytic vesicle	ISS
GO:0098793	Component	Presynapse	IEA
GO:0098978	Component	Glutamatergic synapse	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q6XYQ8

Protein name

Synaptotagmin-10 (Synaptotagmin X) (SytX)

Protein function

Ca(2+) sensor specifically required for the Ca(2+)-dependent exocytosis of secretory vesicles containing IGF1 in neurons of the olfactory bulb. Exocytosis of IGF1 is required for sensory perception of smell. Not involved in Ca(2+)-dependent syna

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00168	C2	246 → 354	C2 domain	Domain
PF00168	C2	378 → 498	C2 domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed only in pancreas, lung and kidney. {ECO:0000269|PubMed:14756426}.

Sequence

MSFHKEDGVNSLCQKALHIVTELCFAGQVEWEKCSGIFPRDRGSQGGSSTDISVSLLAVV
VSFCGLALLVVSLFVFWKLCWPCWKSKPVTSNITTLPQSISSAPTEVFETEEKKEIKENE
KPAVKAIEPAIKISHTSPDIPAEVQTALKEHLIKHARVQRQITEPTSSTRHSSFRRHLPR
QMQVSSVDFSMGTEPVLQRGETTTSIGRIKPELYKQKSVDSEGNQNEDVKICGKLNFTLQ
YDYENELLVVKIIKALDLPAKDFTGTSDPYVKMYLLPDRKKKFQTRVHRKTLNPLFDETF
QFPVAYDQLSNRKLHFSVYDFDRFSRHDMIGEVILDNLFEVSDLSREATVWKDIHCATTE
SIDLGEIMFSLCYLPTAGRMTLTVIKCRNLKAMDITGSSDPYVKVSLMCEGRRLKKRKTT
TKKNTLNPVYNEAIIFDIPPENVDQVSLSIAVMDYDRVGHNEVIGVCRTGLDAEGLGRDH
WNEMLAYHRKPITHWHPLLELPGRATSFDSQGSCPSPKPPSTP

Sequence length

523

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (7)
ANXIETY DISORDER	—	GWAS catalog	36658263	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	40050429	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIVERTICULAR DISEASE	—	GWAS catalog	37492107	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	27182965, 32201043	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	30019117	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	32541925, 35551307, 38374256, 38685053, 39349817	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
nervous system disorder	Nervous System Disorder	BEFREE	26936998		★★★★★ ★☆☆☆☆ Found in Text Mining only

SYT10 (synaptotagmin 10)

Bookmark This Gene