ST7 (suppression of tumorigenicity 7)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 7982
• Gene name: Suppression of tumorigenicity 7
• Gene symbol: ST7
• Synonyms (NCBI Gene): ETS7q, FAM4A, FAM4A1, HELG, RAY1, SEN4, TSG7
• Chromosome: 7
• Chromosome location: 7q31.2
• Summary: The gene for this product maps to a region on chromosome 7 identified as an autism-susceptibility locus. Mutation screening of the entire coding region in autistic individuals failed to identify phenotype-specific variants, suggesting that coding mutation

miRNA Show/Hide all (103)

miRTarBase ID	miRNA	Experiments	Reference
MIRT1393806	hsa-miR-1273f	CLIP-seq
MIRT1393807	hsa-miR-1294	CLIP-seq
MIRT1393808	hsa-miR-3656	CLIP-seq
MIRT1393809	hsa-miR-3960	CLIP-seq
MIRT1393810	hsa-miR-4710	CLIP-seq
MIRT1393811	hsa-miR-885-3p	CLIP-seq
MIRT1393812	hsa-miR-124	CLIP-seq
MIRT1393813	hsa-miR-19a	CLIP-seq
MIRT1393814	hsa-miR-19b	CLIP-seq
MIRT1393815	hsa-miR-4708-3p	CLIP-seq
MIRT1393816	hsa-miR-4729	CLIP-seq
MIRT1393817	hsa-miR-506	CLIP-seq
MIRT1393818	hsa-miR-518a-5p	CLIP-seq
MIRT1393819	hsa-miR-527	CLIP-seq
MIRT1393820	hsa-miR-556-5p	CLIP-seq
MIRT1393821	hsa-miR-570	CLIP-seq
MIRT1393813	hsa-miR-19a	CLIP-seq
MIRT1393814	hsa-miR-19b	CLIP-seq
MIRT2395262	hsa-miR-3179	CLIP-seq
MIRT2395263	hsa-miR-4761-3p	CLIP-seq
MIRT2433622	hsa-miR-3150a-3p	CLIP-seq
MIRT2634122	hsa-miR-1180	CLIP-seq
MIRT2634123	hsa-miR-1193	CLIP-seq
MIRT2634124	hsa-miR-186	CLIP-seq
MIRT2634125	hsa-miR-299-3p	CLIP-seq
MIRT2634126	hsa-miR-3133	CLIP-seq
MIRT2433622	hsa-miR-3150a-3p	CLIP-seq
MIRT2634127	hsa-miR-3151	CLIP-seq
MIRT2634128	hsa-miR-3163	CLIP-seq
MIRT2634129	hsa-miR-3165	CLIP-seq
MIRT2634130	hsa-miR-3175	CLIP-seq
MIRT2634131	hsa-miR-3202	CLIP-seq
MIRT2634132	hsa-miR-320a	CLIP-seq
MIRT2634133	hsa-miR-320b	CLIP-seq
MIRT2634134	hsa-miR-320c	CLIP-seq
MIRT2634135	hsa-miR-320d	CLIP-seq
MIRT2634136	hsa-miR-3611	CLIP-seq
MIRT2634137	hsa-miR-3691-5p	CLIP-seq
MIRT2634138	hsa-miR-411	CLIP-seq
MIRT2634139	hsa-miR-4429	CLIP-seq
MIRT2634140	hsa-miR-4446-3p	CLIP-seq
MIRT2634141	hsa-miR-4447	CLIP-seq
MIRT2634142	hsa-miR-4472	CLIP-seq
MIRT2634143	hsa-miR-4493	CLIP-seq
MIRT2634144	hsa-miR-4511	CLIP-seq
MIRT2634145	hsa-miR-4533	CLIP-seq
MIRT2634146	hsa-miR-4651	CLIP-seq
MIRT2634147	hsa-miR-4664-3p	CLIP-seq
MIRT2634148	hsa-miR-4709-3p	CLIP-seq
MIRT2634149	hsa-miR-4730	CLIP-seq
MIRT2634150	hsa-miR-4764-5p	CLIP-seq
MIRT2634151	hsa-miR-491-5p	CLIP-seq
MIRT2634152	hsa-miR-496	CLIP-seq
MIRT2634153	hsa-miR-512-5p	CLIP-seq
MIRT2634154	hsa-miR-608	CLIP-seq
MIRT2634155	hsa-miR-658	CLIP-seq
MIRT2634156	hsa-miR-939	CLIP-seq
MIRT2634122	hsa-miR-1180	CLIP-seq
MIRT2634123	hsa-miR-1193	CLIP-seq
MIRT2692133	hsa-miR-1255a	CLIP-seq
MIRT2692134	hsa-miR-1255b	CLIP-seq
MIRT2692135	hsa-miR-1293	CLIP-seq
MIRT2634124	hsa-miR-186	CLIP-seq
MIRT2634125	hsa-miR-299-3p	CLIP-seq
MIRT2692136	hsa-miR-3120-3p	CLIP-seq
MIRT2634126	hsa-miR-3133	CLIP-seq
MIRT2433622	hsa-miR-3150a-3p	CLIP-seq
MIRT2634127	hsa-miR-3151	CLIP-seq
MIRT2634128	hsa-miR-3163	CLIP-seq
MIRT2634129	hsa-miR-3165	CLIP-seq
MIRT2634130	hsa-miR-3175	CLIP-seq
MIRT2395262	hsa-miR-3179	CLIP-seq
MIRT2634131	hsa-miR-3202	CLIP-seq
MIRT2634132	hsa-miR-320a	CLIP-seq
MIRT2634133	hsa-miR-320b	CLIP-seq
MIRT2634134	hsa-miR-320c	CLIP-seq
MIRT2634135	hsa-miR-320d	CLIP-seq
MIRT2634136	hsa-miR-3611	CLIP-seq
MIRT2692137	hsa-miR-3681	CLIP-seq
MIRT2634137	hsa-miR-3691-5p	CLIP-seq
MIRT2634138	hsa-miR-411	CLIP-seq
MIRT2634139	hsa-miR-4429	CLIP-seq
MIRT2634140	hsa-miR-4446-3p	CLIP-seq
MIRT2634141	hsa-miR-4447	CLIP-seq
MIRT2692138	hsa-miR-4468	CLIP-seq
MIRT2634142	hsa-miR-4472	CLIP-seq
MIRT2692139	hsa-miR-4483	CLIP-seq
MIRT2634143	hsa-miR-4493	CLIP-seq
MIRT2634144	hsa-miR-4511	CLIP-seq
MIRT2634145	hsa-miR-4533	CLIP-seq
MIRT2692140	hsa-miR-4645-3p	CLIP-seq
MIRT2634146	hsa-miR-4651	CLIP-seq
MIRT2634147	hsa-miR-4664-3p	CLIP-seq
MIRT2634148	hsa-miR-4709-3p	CLIP-seq
MIRT2395263	hsa-miR-4761-3p	CLIP-seq
MIRT2634150	hsa-miR-4764-5p	CLIP-seq
MIRT2634151	hsa-miR-491-5p	CLIP-seq
MIRT2634152	hsa-miR-496	CLIP-seq
MIRT2634153	hsa-miR-512-5p	CLIP-seq
MIRT2692141	hsa-miR-542-3p	CLIP-seq
MIRT2692142	hsa-miR-545	CLIP-seq
MIRT2634154	hsa-miR-608	CLIP-seq
MIRT2634156	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	30945288
GO:0016020	Component	Membrane	IEA
GO:0030198	Process	Extracellular matrix organization	NAS	16474848
GO:0045595	Process	Regulation of cell differentiation	NAS	16474848

Other IDs

• MIM: 600833
• HGNC: 11351
• e!Ensembl: ENSG00000004866

Protein

• UniProt ID: Q9NRC1
• Protein name: Suppressor of tumorigenicity 7 protein (Protein FAM4A1) (Protein HELG)
• Protein function: May act as a tumor suppressor.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF04184	ST7	17 → 562	ST7 protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Ubiquitously expressed, with highest levels in heart, liver and pancreas. {ECO:0000269|PubMed:10889047, ECO:0000269|PubMed:11279520}.
• Sequence:

  MAEAATGFLEQLKSCIVWSWTYLWTVWFFIVLFLVYILRVPLKINDNLSTVSMFLNTLTP
  KFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQVSVSHLRPLLGGVDNNSSNNSNSSN
  GDSDSNRQSVSECKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQTFFTCDS
  DHLRPADAIMQKAWRERNPQARISAAHEALEINEIRSRVEVPLIASSTIWEIKLLPKCAT
  AYILLAEEEATTIAEAEKLFKQALKAGDGCYRRSQQLQHHGSQYEAQHRRDTNVLVYIKR
  RLAMCARRLGRTREAVKMMRDLMKEFPLLSMFNIHENLLEALLELQAYADVQAVLAKYDD
  ISLPKSATICYTAALLKARAVSDKFSPEAASRRGLSTAEMNAVEAIHRAVEFNPHVPKYL
  LEMKSLILPPEHILKRGDSEAIAYAFFHLAHWKRVEGALNLLHCTWEGTFRMIPYPLEKG
  HLFYPYPICTETADRELLPSFHEVSVYPKKELPFFILFTAGLCSFTAMLALLTHQFPELM
  GVFAKAMIDIFCSAEFRDWNCKSIFMRVEDELEIPPAPQSQHFQN

• Sequence length: 585

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Brain atrophy	Likely pathogenic	rs550492993	RCV000162112	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Global developmental delay	Likely pathogenic	rs550492993	RCV000162112	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intractable seizure	Likely pathogenic	rs550492993	RCV000162112	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations Show/Hide Unknown Diseases (23)
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Acute myeloid leukemia	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Adrenocortical carcinoma, hereditary	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CROHN'S DISEASE	—	GWAS catalog	23128233, 28067908	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DUPUYTREN CONTRACTURE	—	GWAS catalog	28886342, 38172110	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EARLY INFANTILE EPILEPTIC ENCEPHALOPATHY WITH SUPPRESSION BURSTS	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIOSIS	—	GWAS catalog	32121467	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC DEVELOPMENTAL AND EPILEPTIC ENCEPHALOPATHY	—	GenCC	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	36810956	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	23128233, 28067908	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung cancer	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	32121467	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES, INTRACTABLE	—	Disgenet	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ST7-related disorder	Likely benign; Benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	23128233, 26192919, 28067908, 37156999	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Genes

Sort by: Blended Diseases Pathways Evidence source

CFAP96 2 shared diseasesDevelopmental and epileptic encephalopathy, Seizures 2 shared evidence sourcesDisgenet (Developmental and epileptic encephalopathy), Disgenet (Seizures) Related via 2 shared diseases including Developmental and epileptic encephalopathy, Seizures — evidence mostly Disgenet. SRGAP2 2 shared diseasesDevelopmental and epileptic encephalopathy, Dupuytren contracture 2 shared evidence sourcesDisgenet (Developmental and epileptic encephalopathy), GWAS catalog (Dupuytren contracture) Related via 2 shared diseases including Developmental and epileptic encephalopathy, Dupuytren contracture — evidence mostly Disgenet. ATP6V0A1 2 shared diseasesDevelopmental and epileptic encephalopathy, Seizures 2 shared evidence sourcesDisgenet (Developmental and epileptic encephalopathy), Disgenet (Seizures) Related via 2 shared diseases including Developmental and epileptic encephalopathy, Seizures — evidence mostly Disgenet. PIGQ 2 shared diseasesDevelopmental and epileptic encephalopathy, Seizures 2 shared evidence sourcesDisgenet (Developmental and epileptic encephalopathy), Disgenet (Seizures) Related via 2 shared diseases including Developmental and epileptic encephalopathy, Seizures — evidence mostly Disgenet. KCNA2 2 shared diseasesDevelopmental and epileptic encephalopathy, Seizures 1 shared evidence sourceDisgenet (Developmental and epileptic encephalopathy) Related via 2 shared diseases including Developmental and epileptic encephalopathy, Seizures — evidence mostly Disgenet.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
CFAP96	2	["Developmental and epileptic encephalopathy","Seizures"]	0	[]	2	["Disgenet (Developmental and epileptic encephalopathy)","Disgenet (Seizures)"]
SRGAP2	2	["Developmental and epileptic encephalopathy","Dupuytren contracture"]	0	[]	2	["Disgenet (Developmental and epileptic encephalopathy)","GWAS catalog (Dupuytren contracture)"]
ATP6V0A1	2	["Developmental and epileptic encephalopathy","Seizures"]	0	[]	2	["Disgenet (Developmental and epileptic encephalopathy)","Disgenet (Seizures)"]
PIGQ	2	["Developmental and epileptic encephalopathy","Seizures"]	0	[]	2	["Disgenet (Developmental and epileptic encephalopathy)","Disgenet (Seizures)"]
KCNA2	2	["Developmental and epileptic encephalopathy","Seizures"]	0	[]	1	["Disgenet (Developmental and epileptic encephalopathy)"]

Diseases Linked via Similar Genes

Intellectual developmental disorder Linked via 4 of 5 related genesCFAP96, SRGAP2, ATP6V0A1, KCNA2 Asthma Linked via 2 of 5 related genesSRGAP2, ATP6V0A1 Neurodevelopmental disorder Linked via 2 of 5 related genesATP6V0A1, KCNA2 Non-specific syndromic intellectual disability Linked via 2 of 5 related genesATP6V0A1, KCNA2 Congenital neurologic anomalies Linked via 1 of 5 related genesCFAP96

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Intellectual developmental disorder	4	["CFAP96","SRGAP2","ATP6V0A1","KCNA2"]
Asthma	2	["SRGAP2","ATP6V0A1"]
Neurodevelopmental disorder	2	["ATP6V0A1","KCNA2"]
Non-specific syndromic intellectual disability	2	["ATP6V0A1","KCNA2"]
Congenital neurologic anomalies	1	["CFAP96"]