Gene Gene information from NCBI Gene database. Download as csv Download as pdf
Entrez ID	10011
Gene name	Steroid receptor RNA activator 1
Gene symbol	SRA1
Synonyms (NCBI Gene)	SRASRAPSTRAA1pp7684
Chromosome	5
Chromosome location	5q31.3
Summary	Both long non-coding and protein-coding RNAs are transcribed from this gene, and they represent alternatively spliced transcript variants. This gene was initially defined as a non-coding RNA, which is a coactivator for several nuclear receptors (NRs) and

124 Show/Hide all (124)

miRTarBase ID	miRNA	Experiments	Reference
MIRT439547	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439547	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1387592	hsa-miR-1271	CLIP-seq
MIRT1387593	hsa-miR-182	CLIP-seq
MIRT1387594	hsa-miR-1827	CLIP-seq
MIRT1387595	hsa-miR-216a	CLIP-seq
MIRT1387596	hsa-miR-31	CLIP-seq
MIRT1387597	hsa-miR-3663-5p	CLIP-seq
MIRT1387598	hsa-miR-4264	CLIP-seq
MIRT1387599	hsa-miR-4797-3p	CLIP-seq
MIRT1387600	hsa-miR-759	CLIP-seq
MIRT1387601	hsa-miR-96	CLIP-seq
MIRT2116118	hsa-miR-1197	CLIP-seq
MIRT2116119	hsa-miR-3131	CLIP-seq
MIRT2116120	hsa-miR-4453	CLIP-seq
MIRT2116121	hsa-miR-4538	CLIP-seq
MIRT2116122	hsa-miR-4652-5p	CLIP-seq
MIRT2116123	hsa-miR-4661-5p	CLIP-seq
MIRT2116124	hsa-miR-611	CLIP-seq
MIRT2116118	hsa-miR-1197	CLIP-seq
MIRT1387592	hsa-miR-1271	CLIP-seq
MIRT2338541	hsa-miR-151-5p	CLIP-seq
MIRT2338542	hsa-miR-151b	CLIP-seq
MIRT2116119	hsa-miR-3131	CLIP-seq
MIRT2338543	hsa-miR-3202	CLIP-seq
MIRT2338544	hsa-miR-3678-3p	CLIP-seq
MIRT2338545	hsa-miR-4270	CLIP-seq
MIRT2338546	hsa-miR-4436b-3p	CLIP-seq
MIRT2338547	hsa-miR-4441	CLIP-seq
MIRT2116120	hsa-miR-4453	CLIP-seq
MIRT2116121	hsa-miR-4538	CLIP-seq
MIRT2116122	hsa-miR-4652-5p	CLIP-seq
MIRT2116123	hsa-miR-4661-5p	CLIP-seq
MIRT2338548	hsa-miR-4668-5p	CLIP-seq
MIRT2338549	hsa-miR-4672	CLIP-seq
MIRT2116124	hsa-miR-611	CLIP-seq
MIRT1387601	hsa-miR-96	CLIP-seq
MIRT2395145	hsa-miR-3154	CLIP-seq
MIRT2632064	hsa-miR-1273f	CLIP-seq
MIRT2632065	hsa-miR-1273g	CLIP-seq
MIRT2632066	hsa-miR-1302	CLIP-seq
MIRT2632067	hsa-miR-130a	CLIP-seq
MIRT2632068	hsa-miR-130b	CLIP-seq
MIRT2632069	hsa-miR-148a	CLIP-seq
MIRT2632070	hsa-miR-148b	CLIP-seq
MIRT2632071	hsa-miR-152	CLIP-seq
MIRT2632072	hsa-miR-194	CLIP-seq
MIRT2632073	hsa-miR-1972	CLIP-seq
MIRT2632074	hsa-miR-19a	CLIP-seq
MIRT2632075	hsa-miR-19b	CLIP-seq
MIRT1387595	hsa-miR-216a	CLIP-seq
MIRT2632076	hsa-miR-216b	CLIP-seq
MIRT2632077	hsa-miR-301a	CLIP-seq
MIRT2632078	hsa-miR-301b	CLIP-seq
MIRT2632079	hsa-miR-3117-3p	CLIP-seq
MIRT2632080	hsa-miR-3124-3p	CLIP-seq
MIRT2632081	hsa-miR-3126-5p	CLIP-seq
MIRT2632082	hsa-miR-3136-3p	CLIP-seq
MIRT2395145	hsa-miR-3154	CLIP-seq
MIRT2632083	hsa-miR-3169	CLIP-seq
MIRT2632084	hsa-miR-3176	CLIP-seq
MIRT2632085	hsa-miR-3199	CLIP-seq
MIRT2632086	hsa-miR-323-5p	CLIP-seq
MIRT2632087	hsa-miR-3607-3p	CLIP-seq
MIRT2632088	hsa-miR-3653	CLIP-seq
MIRT2632089	hsa-miR-3666	CLIP-seq
MIRT2632090	hsa-miR-3686	CLIP-seq
MIRT2632091	hsa-miR-3910	CLIP-seq
MIRT2632092	hsa-miR-3922-3p	CLIP-seq
MIRT2632093	hsa-miR-3941	CLIP-seq
MIRT2632094	hsa-miR-4286	CLIP-seq
MIRT2632095	hsa-miR-4295	CLIP-seq
MIRT2632096	hsa-miR-4298	CLIP-seq
MIRT2632097	hsa-miR-4419a	CLIP-seq
MIRT2632098	hsa-miR-4469	CLIP-seq
MIRT2632099	hsa-miR-4480	CLIP-seq
MIRT2632100	hsa-miR-4510	CLIP-seq
MIRT2632101	hsa-miR-454	CLIP-seq
MIRT2632102	hsa-miR-4643	CLIP-seq
MIRT2632103	hsa-miR-4648	CLIP-seq
MIRT2632104	hsa-miR-4650-5p	CLIP-seq
MIRT2632105	hsa-miR-466	CLIP-seq
MIRT2632106	hsa-miR-4669	CLIP-seq
MIRT2338549	hsa-miR-4672	CLIP-seq
MIRT2632107	hsa-miR-4680-5p	CLIP-seq
MIRT2632108	hsa-miR-4726-3p	CLIP-seq
MIRT2632109	hsa-miR-4759	CLIP-seq
MIRT2632110	hsa-miR-4778-3p	CLIP-seq
MIRT2632111	hsa-miR-493	CLIP-seq
MIRT2632112	hsa-miR-511	CLIP-seq
MIRT2632113	hsa-miR-515-5p	CLIP-seq
MIRT2632114	hsa-miR-542-3p	CLIP-seq
MIRT2632115	hsa-miR-576-5p	CLIP-seq
MIRT2632116	hsa-miR-627	CLIP-seq
MIRT2632117	hsa-miR-642a	CLIP-seq
MIRT2632118	hsa-miR-653	CLIP-seq
MIRT2632119	hsa-miR-876-3p	CLIP-seq
MIRT2632120	hsa-miR-924	CLIP-seq
MIRT2632064	hsa-miR-1273f	CLIP-seq
MIRT2632066	hsa-miR-1302	CLIP-seq
MIRT2632073	hsa-miR-1972	CLIP-seq
MIRT2632082	hsa-miR-3136-3p	CLIP-seq
MIRT2395145	hsa-miR-3154	CLIP-seq
MIRT2632084	hsa-miR-3176	CLIP-seq
MIRT2632085	hsa-miR-3199	CLIP-seq
MIRT2632086	hsa-miR-323-5p	CLIP-seq
MIRT2632088	hsa-miR-3653	CLIP-seq
MIRT2632091	hsa-miR-3910	CLIP-seq
MIRT2632092	hsa-miR-3922-3p	CLIP-seq
MIRT2632096	hsa-miR-4298	CLIP-seq
MIRT2632098	hsa-miR-4469	CLIP-seq
MIRT2632099	hsa-miR-4480	CLIP-seq
MIRT2632102	hsa-miR-4643	CLIP-seq
MIRT2632103	hsa-miR-4648	CLIP-seq
MIRT2632104	hsa-miR-4650-5p	CLIP-seq
MIRT2632106	hsa-miR-4669	CLIP-seq
MIRT2632107	hsa-miR-4680-5p	CLIP-seq
MIRT2632108	hsa-miR-4726-3p	CLIP-seq
MIRT2632110	hsa-miR-4778-3p	CLIP-seq
MIRT2632111	hsa-miR-493	CLIP-seq
MIRT2632113	hsa-miR-515-5p	CLIP-seq
MIRT2632114	hsa-miR-542-3p	CLIP-seq
MIRT2632117	hsa-miR-642a	CLIP-seq
MIRT2632119	hsa-miR-876-3p	CLIP-seq

21 Show/Hide all (21)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002153	Function	Steroid receptor RNA activator RNA binding	IDA	24486609, 24486611
GO:0002153	Function	Steroid receptor RNA activator RNA binding	IDA	20855289
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0005515	Function	Protein binding	IPI	20398657
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	12565891, 24486609, 27086651
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IDA	24486609, 27086651
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IDA
GO:0005929	Component	Cilium	IDA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IMP	24486609
GO:0006915	Process	Apoptotic process	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA
GO:0045171	Component	Intercellular bridge	IDA
GO:0045662	Process	Negative regulation of myoblast differentiation	IMP	20855289
GO:0045893	Process	Positive regulation of DNA-templated transcription	IEA
GO:1990904	Component	Ribonucleoprotein complex	IDA	24486609

MIM	HGNC	e!Ensembl
603819	11281	ENSG00000213523

Q9HD15

Protein name

Steroid receptor RNA activator 1 (Steroid receptor RNA activator protein) (SRAP)

Protein function

Functional RNA which acts as a transcriptional coactivator that selectively enhances steroid receptor-mediated transactivation ligand-independently through a mechanism involving the modulating N-terminal domain (AF-1) of steroid receptors. Also

PDB

2MGX , 4NBO

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF07304	SRA1	75 → 219	Steroid receptor RNA activator (SRA1)	Family

Tissue specificity

TISSUE SPECIFICITY: Highly expressed in liver and skeletal muscle and to a lesser extent in brain. Also expressed in both normal and tumorigenic breast epithelial cell lines. Significantly up-regulated in human tumors of the breast, ovary, and uterus. {EC

Sequence

MTRCPAGQAEVEMAELYVKPGNKERGWNDPPQFSYGLQTQAGGPRRSLLTKRVAAPQDGS
PRVPASETSPGPPPMGPPPPSSKAPRSPPVGSGPASGVEPTSFPVESEAVMEDVLRPLEQ
ALEDCRGHTRKQVCDDISRRLALLQEQWAGGKLSIPVKKRMALLVQELSSHRWDAADDIH
RSLMVDHVTEVSQWMVGVKRLIAEKRSLFSEEAANEEKSAATAEKNHTIPGFQQAS

Sequence length

236

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal. Show/Hide Unknown Diseases (15)
Amenorrhea	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypogonadism with anosmia	Uncertain significance	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADOTROPIC HYPOGONADISM	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOGONADOTROPIC HYPOGONADISM 7 WITH OR WITHOUT ANOSMIA	—	ClinVar, HPO ClinVar, HPO	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOPITUITARISM	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC GROWTH HORMONE DEFICIENCY	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
IDIOPATHIC HYPOGONADOTROPIC HYPOGONADISM	—	CTD, Disgenet CTD, Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KALLMANN SYNDROME	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANHYPOPITUITARISM	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY DWARFISM	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PITUITARY SHORT STATURE	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESTLESS LEGS SYNDROME	—	GWAS catalog	38839884	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SHEEHAN SYNDROME	—	Disgenet	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SRA1-related disorder	Benign; Likely benign	ClinVar	—	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
FEZF1	8	["Hypogonadotropic hypogonadism","Hypopituitarism","Growth hormone deficiency","Kallmann syndrome","Panhypopituitarism","Pituitary dwarfism","Pituitary short stature","Sheehan syndrome"]	[]	11	["Disgenet (Hypogonadotropic hypogonadism)","CTD (Hypogonadotropic hypogonadism)","ClinVar (Hypogonadotropic hypogonadism)","HPO (Hypogonadotropic hypogonadism)","Disgenet (Hypopituitarism)","Disgenet (Growth hormone deficiency)","Disgenet (Kallmann syndrome)","Disgenet (Panhypopituitarism)","Disgenet (Pituitary dwarfism)","Disgenet (Pituitary short stature)","Disgenet (Sheehan syndrome)"]
FGF17	8	["Hypogonadotropic hypogonadism","Hypopituitarism","Growth hormone deficiency","Kallmann syndrome","Panhypopituitarism","Pituitary dwarfism","Pituitary short stature","Sheehan syndrome"]	[]	11	["Disgenet (Hypogonadotropic hypogonadism)","CTD (Hypogonadotropic hypogonadism)","ClinVar (Hypogonadotropic hypogonadism)","HPO (Hypogonadotropic hypogonadism)","Disgenet (Hypopituitarism)","Disgenet (Growth hormone deficiency)","Disgenet (Kallmann syndrome)","Disgenet (Panhypopituitarism)","Disgenet (Pituitary dwarfism)","Disgenet (Pituitary short stature)","Disgenet (Sheehan syndrome)"]
GNRHR	8	["Hypogonadotropic hypogonadism","Hypopituitarism","Growth hormone deficiency","Kallmann syndrome","Panhypopituitarism","Pituitary dwarfism","Pituitary short stature","Sheehan syndrome"]	[]	11	["Disgenet (Hypogonadotropic hypogonadism)","CTD (Hypogonadotropic hypogonadism)","ClinVar (Hypogonadotropic hypogonadism)","HPO (Hypogonadotropic hypogonadism)","Disgenet (Hypopituitarism)","Disgenet (Growth hormone deficiency)","Disgenet (Kallmann syndrome)","Disgenet (Panhypopituitarism)","Disgenet (Pituitary dwarfism)","Disgenet (Pituitary short stature)","Disgenet (Sheehan syndrome)"]
HS6ST1	8	["Hypogonadotropic hypogonadism","Hypopituitarism","Growth hormone deficiency","Kallmann syndrome","Panhypopituitarism","Pituitary dwarfism","Pituitary short stature","Sheehan syndrome"]	[]	10	["Disgenet (Hypogonadotropic hypogonadism)","CTD (Hypogonadotropic hypogonadism)","ClinVar (Hypogonadotropic hypogonadism)","Disgenet (Hypopituitarism)","Disgenet (Growth hormone deficiency)","Disgenet (Kallmann syndrome)","Disgenet (Panhypopituitarism)","Disgenet (Pituitary dwarfism)","Disgenet (Pituitary short stature)","Disgenet (Sheehan syndrome)"]
NHLH2	8	["Hypogonadotropic hypogonadism","Hypopituitarism","Growth hormone deficiency","Kallmann syndrome","Panhypopituitarism","Pituitary dwarfism","Pituitary short stature","Sheehan syndrome"]	[]	10	["Disgenet (Hypogonadotropic hypogonadism)","ClinVar (Hypogonadotropic hypogonadism)","HPO (Hypogonadotropic hypogonadism)","Disgenet (Hypopituitarism)","Disgenet (Growth hormone deficiency)","Disgenet (Kallmann syndrome)","Disgenet (Panhypopituitarism)","Disgenet (Pituitary dwarfism)","Disgenet (Pituitary short stature)","Disgenet (Sheehan syndrome)"]

SRA1 (steroid receptor RNA activator 1)

Bookmark This Gene