SPDYE13 (speedy/RINGO cell cycle regulator family member E13)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 105180390
Gene name Speedy/RINGO cell cycle regulator family member E13
Gene symbol SPDYE13
Synonyms (NCBI Gene)
SPDYE13P
Chromosome 7
Chromosome location 7q11.23
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A0A494C0Z2
Protein name Speedy protein E13
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11357 Spy1 107 → 220 Cell cycle regulatory protein Family
PF11357 Spy1 212 → 261 Cell cycle regulatory protein Family
Sequence 
MGQILGKIMMSHQPQPQEERSPQRSTSGYPLQEVVDDEVLGPSAPGVDPSPPRRSLGWKR
KRECLDESDDEPEKELAPEPEETWVAETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPV
IKRLLAWDKDLRVSDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEAPKQ
NIFYFLYEETRSHIPLLSELWFQLCRYMNPRARKNCSQIALFRKYRFHFFCSMRCRAWVS
LEELEEIQAYDPEHWVWARDRAHLS
Sequence length 265
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Oocyte meiosis
Progesterone-mediated oocyte maturation
Sort by:
SPDYE12 2 shared pathwaysOocyte meiosis, Progesterone-mediated oocyte maturation Related via 2 shared pathways including Oocyte meiosis, Progesterone-mediated oocyte maturation. SPDYE2B 2 shared pathwaysOocyte meiosis, Progesterone-mediated oocyte maturation Related via 2 shared pathways including Oocyte meiosis, Progesterone-mediated oocyte maturation. SPDYE18 2 shared pathwaysOocyte meiosis, Progesterone-mediated oocyte maturation Related via 2 shared pathways including Oocyte meiosis, Progesterone-mediated oocyte maturation. SPDYE11 2 shared pathwaysOocyte meiosis, Progesterone-mediated oocyte maturation Related via 2 shared pathways including Oocyte meiosis, Progesterone-mediated oocyte maturation. SPDYE16 2 shared pathwaysOocyte meiosis, Progesterone-mediated oocyte maturation Related via 2 shared pathways including Oocyte meiosis, Progesterone-mediated oocyte maturation.
Breast cancer Linked via 1 of 5 related genesSPDYE12 Estrogen-receptor negative breast cancer Linked via 1 of 5 related genesSPDYE12 Hypertension Linked via 1 of 5 related genesSPDYE18