SPDYE16 (speedy/RINGO cell cycle regulator family member E16)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 102723555
Gene name Speedy/RINGO cell cycle regulator family member E16
Gene symbol SPDYE16
Synonyms (NCBI Gene)
-
Chromosome 7
Chromosome location 7q11.23
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0019901 Function Protein kinase binding IBA
GO:0019901 Function Protein kinase binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NNV3
Protein name Speedy protein E16 (Speedy/RINGO cell cycle regulator family member E16)
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11357 Spy1 154 → 265 Cell cycle regulatory protein Family
PF11357 Spy1 259 → 308 Cell cycle regulatory protein Family
Sequence 
MQKHYTVAWFLYSAPGVDPSPPCRSLGWKRKKEWSDESEEEPEKELAPEPEETWVVEMLC
GLKMKLKQQRVSPILPEHHKDFNSQLAPGVDPSPPHRSFCWKRKREWWDESEESLEEEPR
KVLAPEPEEIWVVEMLCGLKMKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRV
SDKYLLAMVIAYFSRAGLPSWQYQRIHFFLALYLANDMEEDDEDPKQNIFYFLYGKTRSR
IPLVRNRRFQLCRCMNPRARKNRSQIALFQKLRFQFFCSMSGRAWVSREELEEIQAYDPE
HWVWARDRARLS
Sequence length 312
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Oocyte meiosis
Progesterone-mediated oocyte maturation
Sort by:
SPDYE12 2 shared pathwaysOocyte meiosis, Progesterone-mediated oocyte maturation Related via 2 shared pathways including Oocyte meiosis, Progesterone-mediated oocyte maturation. SPDYE2B 2 shared pathwaysOocyte meiosis, Progesterone-mediated oocyte maturation Related via 2 shared pathways including Oocyte meiosis, Progesterone-mediated oocyte maturation. SPDYE18 2 shared pathwaysOocyte meiosis, Progesterone-mediated oocyte maturation Related via 2 shared pathways including Oocyte meiosis, Progesterone-mediated oocyte maturation. SPDYE11 2 shared pathwaysOocyte meiosis, Progesterone-mediated oocyte maturation Related via 2 shared pathways including Oocyte meiosis, Progesterone-mediated oocyte maturation. SPDYE17 2 shared pathwaysOocyte meiosis, Progesterone-mediated oocyte maturation Related via 2 shared pathways including Oocyte meiosis, Progesterone-mediated oocyte maturation.
Breast cancer Linked via 1 of 5 related genesSPDYE12 Estrogen-receptor negative breast cancer Linked via 1 of 5 related genesSPDYE12 Hypertension Linked via 1 of 5 related genesSPDYE18