SPDYE2B (speedy/RINGO cell cycle regulator family member E2B)

Download as csv Download as pdf
Log in to bookmark this gene

Bookmark This Gene

Gene Gene information from NCBI Gene database.
Download as csvDownload as pdf
Entrez ID 100310812
Gene name Speedy/RINGO cell cycle regulator family member E2B
Gene symbol SPDYE2B
Synonyms (NCBI Gene)
SPDYE2L
Chromosome 7
Chromosome location 7q22.1
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
2
Download as csvDownload as pdf
GO ID Ontology Definition Evidence Reference
GO:0019901 Function Protein kinase binding IBA
GO:0019901 Function Protein kinase binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Download as csvDownload as pdf
MIM HGNC e!Ensembl
HGNC N/A HGNC
Protein Protein information from UniProt database.
Download as csvDownload as pdf
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
A6NHP3
Protein name Speedy protein E2B
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF11357 Spy1 194 → 313 Cell cycle regulatory protein Family
PF11357 Spy1 349 → 398 Cell cycle regulatory protein Family
Sequence 
MDRTETRFRKRGQITGKITTSRQPHPQNEQSPQRSTSGYPLQEVVDDEMLGPSAPGVDPS
PPCRSLGWKRKREWSDESEEEPEKELAPEPEETWVVEMLCGLKMKLKQQRVSSILPEHHK
DFNSQLAPGVDPSPPHRSFCWKRKMEWWDESEESLEEEPRKVLAPEPEEIWVAEMLCGLK
MKLKRRRVSLVLPEHHEAFNRLLEDPVIKRFLAWDKDLRVSDKYLLAMVIAYFSRAGFPS
WQYQRIHFFLALYLANDMEEDDEDSKQNIFHFLYRKNRSRIPLLRKPWFQLGHSMNPRAR
KNRSRIPLLRKRRFQLYRSTNPRARKNRSRIPLLRKRRFQLYRSMNSRARKNRSQIVLFQ
KRRFHFFCSMSCRAWVSPEELEEIQAYDPEHWVWARDRAHLS
Sequence length 402
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
Download as csvDownload as pdf
KEGG Pathway
Oocyte meiosis
Progesterone-mediated oocyte maturation
Sort by:
SPDYE12 2 shared pathwaysOocyte meiosis, Progesterone-mediated oocyte maturation Related via 2 shared pathways including Oocyte meiosis, Progesterone-mediated oocyte maturation. SPDYE18 2 shared pathwaysOocyte meiosis, Progesterone-mediated oocyte maturation Related via 2 shared pathways including Oocyte meiosis, Progesterone-mediated oocyte maturation. SPDYE11 2 shared pathwaysOocyte meiosis, Progesterone-mediated oocyte maturation Related via 2 shared pathways including Oocyte meiosis, Progesterone-mediated oocyte maturation. SPDYE16 2 shared pathwaysOocyte meiosis, Progesterone-mediated oocyte maturation Related via 2 shared pathways including Oocyte meiosis, Progesterone-mediated oocyte maturation. SPDYE17 2 shared pathwaysOocyte meiosis, Progesterone-mediated oocyte maturation Related via 2 shared pathways including Oocyte meiosis, Progesterone-mediated oocyte maturation.
Breast cancer Linked via 1 of 5 related genesSPDYE12 Estrogen-receptor negative breast cancer Linked via 1 of 5 related genesSPDYE12 Hypertension Linked via 1 of 5 related genesSPDYE18