SLC25A14 (solute carrier family 25 member 14)

Download as csv Download as pdf

Log in to bookmark this gene

Bookmark This Gene

Title Project / Tag (optional) Note (optional)

Cancel Save

On this page

Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases Related genes Diseases linked via similar genes

Gene

• Entrez ID: 9016
• Gene name: Solute carrier family 25 member 14
• Gene symbol: SLC25A14
• Synonyms (NCBI Gene): BMCP1, UCP5
• Chromosome: X
• Chromosome location: Xq26.1
• Summary: Mitochondrial uncoupling proteins (UCP) are members of the larger family of mitochondrial anion carrier proteins (MACP). Uncoupling proteins separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mito

miRNA Show/Hide all (14)

miRTarBase ID	miRNA	Experiments	Reference
MIRT047204	hsa-miR-182-5p	CLASH	23622248
MIRT043502	hsa-miR-331-3p	CLASH	23622248
MIRT2624006	hsa-miR-376a	CLIP-seq
MIRT2624007	hsa-miR-376b	CLIP-seq
MIRT2624008	hsa-miR-4640-5p	CLIP-seq
MIRT2624009	hsa-miR-4667-5p	CLIP-seq
MIRT2624010	hsa-miR-4700-5p	CLIP-seq
MIRT2624011	hsa-miR-4726-5p	CLIP-seq
MIRT2624012	hsa-miR-637	CLIP-seq
MIRT2624006	hsa-miR-376a	CLIP-seq
MIRT2624007	hsa-miR-376b	CLIP-seq
MIRT2624009	hsa-miR-4667-5p	CLIP-seq
MIRT2624010	hsa-miR-4700-5p	CLIP-seq
MIRT2624012	hsa-miR-637	CLIP-seq

Gene ontology (GO) Show/Hide all (20)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005452	Function	Solute:inorganic anion antiporter activity	IDA	31356773
GO:0005452	Function	Solute:inorganic anion antiporter activity	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	20600837
GO:0005739	Component	Mitochondrion	IEA
GO:0005739	Component	Mitochondrion	TAS	9852133
GO:0005743	Component	Mitochondrial inner membrane	IEA
GO:0005743	Component	Mitochondrial inner membrane	TAS
GO:0005886	Component	Plasma membrane	TAS	9852133
GO:0009060	Process	Aerobic respiration	TAS	9852133
GO:0015078	Function	Proton transmembrane transporter activity	IDA	22524567, 26182433
GO:0015108	Function	Chloride transmembrane transporter activity	IDA	22524567, 26182433
GO:0015698	Process	Inorganic anion transport	IDA	31356773
GO:0016020	Component	Membrane	IEA
GO:0022857	Function	Transmembrane transporter activity	IBA
GO:0042803	Function	Protein homodimerization activity	IDA	26182433
GO:0055085	Process	Transmembrane transport	IEA
GO:1900407	Process	Regulation of cellular response to oxidative stress	IDA	20600837
GO:1902476	Process	Chloride transmembrane transport	IEA
GO:1902600	Process	Proton transmembrane transport	IEA

Other IDs

• MIM: 300242
• HGNC: 10984
• e!Ensembl: ENSG00000102078

Protein

• UniProt ID: O95258
• Protein name: Brain mitochondrial carrier protein 1 (BMCP-1) (Mitochondrial uncoupling protein 5) (UCP 5) (Solute carrier family 25 member 14)
• Protein function: Transports inorganic anions (sulfate, sulfite, thiosulfate and phosphate) and, to a lesser extent, a variety of dicarboxylates (e.g. malonate, malate and citramalate) and, even more so, aspartate and glutamate and tricarboxylates (PubMed:3135677
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00153	Mito_carr	38 → 136	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	137 → 229	Mitochondrial carrier protein	Family
  PF00153	Mito_carr	232 → 325	Mitochondrial carrier protein	Family

• Tissue specificity: TISSUE SPECIFICITY: Mainly expressed in brain (PubMed:10928996). Some expression in testis and pituitary (PubMed:10928996). {ECO:0000269|PubMed:10928996}.
• Sequence:

  MGIFPGIILIFLRVKFATAAVIVSGHQKSTTVSHEMSGLNWKPFVYGGLASIVAEFGTFP
  VDLTKTRLQVQGQSIDARFKEIKYRGMFHALFRICKEEGVLALYSGIAPALLRQASYGTI
  KIGIYQSLKRLFVERLEDETLLINMICGVVSGVISSTIANPTDVLKIRMQAQGSLFQGSM
  IGSFIDIYQQEGTRGLWRGVVPTAQRAAIVVGVELPVYDITKKHLILSGMMGDTILTHFV
  SSFTCGLAGALASNPVDVVRTRMMNQRAIVGHVDLYKGTVDGILKMWKHEGFFALYKGFW
  PNWLRLGPWNIIFFITYEQLKRLQI

• Sequence length: 325

Pathways

Reactome Pathway

The fatty acid cycling model

The proton buffering model

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Reference	Evidence Score
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	—	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining Show/Hide Text Mining Associations (9)
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Brain Infarction	Brain Infarction	BEFREE	18018477		★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	22087257	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	22087257	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	35460558	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	22087257	Associate	★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development	Cortical development malformation	Pubtator	30009661	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28130201		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17066476		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	LHGDN	17066476		★☆☆☆☆ Found in Text Mining only

Related Genes

Sort by: Blended Diseases Pathways Evidence source

UCP2 2 shared pathwaysThe fatty acid cycling model, The proton buffering model Related via 2 shared pathways including The fatty acid cycling model, The proton buffering model. UCP3 2 shared pathwaysThe fatty acid cycling model, The proton buffering model Related via 2 shared pathways including The fatty acid cycling model, The proton buffering model. SLC25A27 2 shared pathwaysThe fatty acid cycling model, The proton buffering model Related via 2 shared pathways including The fatty acid cycling model, The proton buffering model. UCP1 2 shared pathwaysThe fatty acid cycling model, The proton buffering model Related via 2 shared pathways including The fatty acid cycling model, The proton buffering model.

Related Gene	Shared Diseases	Shared Disease Names	Shared Pathways	Shared Pathway Names	Shared Evidence Sources	Shared Evidence Names
UCP2	0	[]	2	["The fatty acid cycling model","The proton buffering model"]	0	[]
UCP3	0	[]	2	["The fatty acid cycling model","The proton buffering model"]	0	[]
SLC25A27	0	[]	2	["The fatty acid cycling model","The proton buffering model"]	0	[]
UCP1	0	[]	2	["The fatty acid cycling model","The proton buffering model"]	0	[]

Diseases Linked via Similar Genes

Diabetes mellitus type 2 Linked via 3 of 4 related genesUCP2, UCP3, UCP1 Obesity Linked via 3 of 4 related genesUCP2, UCP3, UCP1 Diabetic neuropathy Linked via 2 of 4 related genesUCP2, UCP3 Hypertension Linked via 2 of 4 related genesUCP2, UCP1 Schizophrenia Linked via 2 of 4 related genesUCP2, SLC25A27

Disease	Linked Via (Gene Count)	Linked Via (Gene Names)
Diabetes mellitus type 2	3	["UCP2","UCP3","UCP1"]
Obesity	3	["UCP2","UCP3","UCP1"]
Diabetic neuropathy	2	["UCP2","UCP3"]
Hypertension	2	["UCP2","UCP1"]
Schizophrenia	2	["UCP2","SLC25A27"]